SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186896986|ref|YP_001874098.1| from Yersinia pseudotuberculosis PB1/+

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186896986|ref|YP_001874098.1|
Domain Number 1 Region: 145-401
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.06e-68
Family N-terminal domain of adrenodoxin reductase-like 0.0022
Further Details:      
 
Domain Number 2 Region: 7-157
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 1.1e-41
Family Dihydropyrimidine dehydrogenase, N-terminal domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186896986|ref|YP_001874098.1|
Sequence length 472
Comment glutamate synthase subunit beta [Yersinia pseudotuberculosis PB1/+]
Sequence
MSQNVYQFIDLQRVDPPKKPLKIRKIEFVEIYEPFSETQAKAQADRCLSCGNPYCEWKCP
VHNYIPNWLKLANEGRIMEAADLAHQTNSLPEVCGRVCPQDRLCEGSCTLNDEFGAVTIG
NIERYISDKAIAMGWKPDMSHVHPTGKRVAVIGAGPAGLACADVLARNGVQAVVFDRHPE
IGGLLTFGIPAFKLEKEVMIKRRKIFSEMGIEFQLNTEVGKDITMEALLKDYDAVFLGVG
TYQSMRGGLENEEANGVYDALPFLIANTKQLMGYEATAHEPYINMQGKRVVVLGGGDTAM
DCVRSSIRQGATDVVCAYRRDEVNMPGSKREVKNAREEGVEFKFNLQPLSIEVNSNGKVC
GVRMVRTQLGAPDAQGRRMAEQIPGSEHVLPADAVVMAFGFRPHSMEWLAAHDVKLDKQG
RVIAPESTDNAFQTSNPKIFAGGDIVRGSDLVVTAIAEGRKAADGIMNYLEV
Download sequence
Identical sequences A0A0E1NXX6 A0A0H2W9U8 A0A0H2YMI1 A0A0H3AZ83 A0A0M1V8W1 A0A0U1EWT2 A0A0U1QWY0 A0A208RX56 A0A2A7VJH7 Q665L4 Q74PS5
gi|384416596|ref|YP_005625958.1| gi|108809736|ref|YP_653652.1| WP_002210138.1.100083 WP_002210138.1.100246 WP_002210138.1.100593 WP_002210138.1.10066 WP_002210138.1.100921 WP_002210138.1.10105 WP_002210138.1.101305 WP_002210138.1.101382 WP_002210138.1.101928 WP_002210138.1.102012 WP_002210138.1.102067 WP_002210138.1.10736 WP_002210138.1.10935 WP_002210138.1.10955 WP_002210138.1.11693 WP_002210138.1.12167 WP_002210138.1.12463 WP_002210138.1.12736 WP_002210138.1.12857 WP_002210138.1.1388 WP_002210138.1.14063 WP_002210138.1.14169 WP_002210138.1.14804 WP_002210138.1.15321 WP_002210138.1.15555 WP_002210138.1.15605 WP_002210138.1.15689 WP_002210138.1.16243 WP_002210138.1.16333 WP_002210138.1.17135 WP_002210138.1.17141 WP_002210138.1.17608 WP_002210138.1.17873 WP_002210138.1.17983 WP_002210138.1.18208 WP_002210138.1.18640 WP_002210138.1.18826 WP_002210138.1.19329 WP_002210138.1.19425 WP_002210138.1.19739 WP_002210138.1.20035 WP_002210138.1.20547 WP_002210138.1.2064 WP_002210138.1.20932 WP_002210138.1.21486 WP_002210138.1.21784 WP_002210138.1.21879 WP_002210138.1.21934 WP_002210138.1.22530 WP_002210138.1.22542 WP_002210138.1.22708 WP_002210138.1.23271 WP_002210138.1.23687 WP_002210138.1.23811 WP_002210138.1.24002 WP_002210138.1.24517 WP_002210138.1.25181 WP_002210138.1.25394 WP_002210138.1.26383 WP_002210138.1.2640 WP_002210138.1.26776 WP_002210138.1.26960 WP_002210138.1.27124 WP_002210138.1.27251 WP_002210138.1.2726 WP_002210138.1.28647 WP_002210138.1.28922 WP_002210138.1.29157 WP_002210138.1.29355 WP_002210138.1.2947 WP_002210138.1.29622 WP_002210138.1.2964 WP_002210138.1.29685 WP_002210138.1.29814 WP_002210138.1.3092 WP_002210138.1.30931 WP_002210138.1.311 WP_002210138.1.31336 WP_002210138.1.31496 WP_002210138.1.31739 WP_002210138.1.31805 WP_002210138.1.32343 WP_002210138.1.32388 WP_002210138.1.32446 WP_002210138.1.32736 WP_002210138.1.33324 WP_002210138.1.33661 WP_002210138.1.33937 WP_002210138.1.34031 WP_002210138.1.34138 WP_002210138.1.35389 WP_002210138.1.35538 WP_002210138.1.36088 WP_002210138.1.37174 WP_002210138.1.37494 WP_002210138.1.37863 WP_002210138.1.38147 WP_002210138.1.38235 WP_002210138.1.38532 WP_002210138.1.38743 WP_002210138.1.38824 WP_002210138.1.38993 WP_002210138.1.39066 WP_002210138.1.39346 WP_002210138.1.3976 WP_002210138.1.40071 WP_002210138.1.40134 WP_002210138.1.40534 WP_002210138.1.40853 WP_002210138.1.41196 WP_002210138.1.41984 WP_002210138.1.42361 WP_002210138.1.42490 WP_002210138.1.42976 WP_002210138.1.44408 WP_002210138.1.44598 WP_002210138.1.44603 WP_002210138.1.44832 WP_002210138.1.45198 WP_002210138.1.45214 WP_002210138.1.46262 WP_002210138.1.46545 WP_002210138.1.46686 WP_002210138.1.46697 WP_002210138.1.46731 WP_002210138.1.46891 WP_002210138.1.47387 WP_002210138.1.47440 WP_002210138.1.47769 WP_002210138.1.47881 WP_002210138.1.48166 WP_002210138.1.48722 WP_002210138.1.4889 WP_002210138.1.49315 WP_002210138.1.49906 WP_002210138.1.4997 WP_002210138.1.50010 WP_002210138.1.50093 WP_002210138.1.50106 WP_002210138.1.50185 WP_002210138.1.50984 WP_002210138.1.51284 WP_002210138.1.51293 WP_002210138.1.51588 WP_002210138.1.51934 WP_002210138.1.52158 WP_002210138.1.52247 WP_002210138.1.52473 WP_002210138.1.52569 WP_002210138.1.52734 WP_002210138.1.52792 WP_002210138.1.52819 WP_002210138.1.52969 WP_002210138.1.53147 WP_002210138.1.53300 WP_002210138.1.53838 WP_002210138.1.53848 WP_002210138.1.53883 WP_002210138.1.53953 WP_002210138.1.54568 WP_002210138.1.54951 WP_002210138.1.55194 WP_002210138.1.55695 WP_002210138.1.5592 WP_002210138.1.56031 WP_002210138.1.56912 WP_002210138.1.56953 WP_002210138.1.57585 WP_002210138.1.57657 WP_002210138.1.58067 WP_002210138.1.58543 WP_002210138.1.58794 WP_002210138.1.59102 WP_002210138.1.59431 WP_002210138.1.5957 WP_002210138.1.59635 WP_002210138.1.59687 WP_002210138.1.59789 WP_002210138.1.59885 WP_002210138.1.60437 WP_002210138.1.60707 WP_002210138.1.60896 WP_002210138.1.61689 WP_002210138.1.62232 WP_002210138.1.62342 WP_002210138.1.6270 WP_002210138.1.6333 WP_002210138.1.63387 WP_002210138.1.63641 WP_002210138.1.64142 WP_002210138.1.64474 WP_002210138.1.64780 WP_002210138.1.64786 WP_002210138.1.64910 WP_002210138.1.653 WP_002210138.1.65400 WP_002210138.1.65554 WP_002210138.1.6570 WP_002210138.1.65706 WP_002210138.1.65718 WP_002210138.1.6581 WP_002210138.1.66546 WP_002210138.1.66616 WP_002210138.1.67404 WP_002210138.1.67850 WP_002210138.1.6791 WP_002210138.1.68361 WP_002210138.1.68371 WP_002210138.1.68855 WP_002210138.1.69018 WP_002210138.1.69316 WP_002210138.1.69951 WP_002210138.1.70117 WP_002210138.1.70171 WP_002210138.1.70319 WP_002210138.1.70377 WP_002210138.1.70417 WP_002210138.1.70726 WP_002210138.1.7083 WP_002210138.1.7169 WP_002210138.1.71744 WP_002210138.1.72280 WP_002210138.1.72440 WP_002210138.1.72486 WP_002210138.1.7402 WP_002210138.1.74131 WP_002210138.1.74310 WP_002210138.1.74738 WP_002210138.1.75173 WP_002210138.1.7518 WP_002210138.1.75208 WP_002210138.1.75337 WP_002210138.1.75407 WP_002210138.1.75636 WP_002210138.1.75821 WP_002210138.1.76555 WP_002210138.1.76670 WP_002210138.1.77387 WP_002210138.1.77429 WP_002210138.1.77691 WP_002210138.1.78004 WP_002210138.1.7841 WP_002210138.1.78556 WP_002210138.1.79515 WP_002210138.1.79550 WP_002210138.1.79609 WP_002210138.1.79981 WP_002210138.1.8009 WP_002210138.1.80331 WP_002210138.1.81848 WP_002210138.1.81877 WP_002210138.1.8210 WP_002210138.1.82133 WP_002210138.1.82151 WP_002210138.1.82270 WP_002210138.1.82436 WP_002210138.1.82619 WP_002210138.1.8303 WP_002210138.1.83039 WP_002210138.1.83265 WP_002210138.1.83630 WP_002210138.1.8420 WP_002210138.1.84703 WP_002210138.1.84720 WP_002210138.1.85269 WP_002210138.1.85270 WP_002210138.1.8559 WP_002210138.1.85802 WP_002210138.1.86034 WP_002210138.1.86059 WP_002210138.1.86413 WP_002210138.1.87107 WP_002210138.1.8728 WP_002210138.1.87418 WP_002210138.1.8762 WP_002210138.1.87853 WP_002210138.1.87988 WP_002210138.1.88362 WP_002210138.1.88472 WP_002210138.1.89359 WP_002210138.1.89542 WP_002210138.1.8964 WP_002210138.1.90176 WP_002210138.1.9051 WP_002210138.1.90624 WP_002210138.1.91263 WP_002210138.1.91373 WP_002210138.1.91844 WP_002210138.1.92030 WP_002210138.1.92331 WP_002210138.1.92604 WP_002210138.1.927 WP_002210138.1.9311 WP_002210138.1.9320 WP_002210138.1.93623 WP_002210138.1.93928 WP_002210138.1.93933 WP_002210138.1.94052 WP_002210138.1.94201 WP_002210138.1.94683 WP_002210138.1.95746 WP_002210138.1.95981 WP_002210138.1.97245 WP_002210138.1.97375 WP_002210138.1.97448 WP_002210138.1.97791 WP_002210138.1.97864 WP_002210138.1.97872 WP_002210138.1.97894 WP_002210138.1.99109 WP_002210138.1.9941 WP_002210138.1.99416 WP_002210138.1.99788 WP_002210138.1.99882 WP_002210138.1.99990 YP_002348445.1.25044 gi|384127576|ref|YP_005510190.1| gi|294505319|ref|YP_003569381.1| gi|45443543|ref|NP_995082.1| gi|186896986|ref|YP_001874098.1| gi|108813600|ref|YP_649367.1| gi|218930570|ref|YP_002348445.1| gi|384138590|ref|YP_005521292.1| gi|51597795|ref|YP_071986.1| gi|384123786|ref|YP_005506406.1| IDP00481 214092.YPO3558 229193.YP_3812 273123.YPTB3503 349747.YpsIP31758_0465 360102.YPA_3745 377628.YPN_3440 386656.YPDSF_0339 502800.YPK_0529 502801.YPTS_3688 gi|170022780|ref|YP_001719285.1| gi|145597655|ref|YP_001161731.1| gi|153948165|ref|YP_001399458.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]