SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186897062|ref|YP_001874174.1| from Yersinia pseudotuberculosis PB1/+

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186897062|ref|YP_001874174.1|
Domain Number 1 Region: 11-319
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 6.04e-88
Family FMN-linked oxidoreductases 0.0000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186897062|ref|YP_001874174.1|
Sequence length 321
Comment tRNA-dihydrouridine synthase B [Yersinia pseudotuberculosis PB1/+]
Sequence
MRIGHFQLTNCLIAAPMAGITDRPFRALCHGMGAGMAVSEMLSSNPEVWRTDKSRLRMVH
VDEPGIRNVQIAGNDPDEMAAAARINVASGAQIIDINMGCPAKKVNRKLAGSALLQHPDL
VKQILSAVVNAVDVPVTLKIRTGWSPEHRNCIEIAQLAENCGIQALTIHGRTRSCLFNGE
AEYDSIRAVKQTVSIPVIANGDITDPHKARAVLDYTGADALMIGRAAQGRPWIFREIQHY
LDTGELLPPMPLGEVQRLLDGHIRELHDFYGPGKGFRIARKHVSWYLQEHAPNDQFRRTF
NAIEDASEQLEALEAYFENLA
Download sequence
Identical sequences A0A0E1NMF9 A0A0E8XL70 A0A0H2YLY4 A0A0H3B0U5 A0A0M1V8Z1 A0A0T9JJV9 A0A0U1ERI0 A0A0U1QYR7 A0A154S8M0 A0A208RZT1 Q665E2 Q8ZAX7
gi|108809658|ref|YP_653574.1| gi|153948925|ref|YP_001399379.1| gi|108813677|ref|YP_649444.1| gi|145597577|ref|YP_001161653.1| gi|384123715|ref|YP_005506335.1| gi|384416678|ref|YP_005626040.1| gi|384138512|ref|YP_005521214.1| gi|294505248|ref|YP_003569310.1| gi|170022704|ref|YP_001719209.1| gi|218930665|ref|YP_002348540.1| WP_002210062.1.100083 WP_002210062.1.100246 WP_002210062.1.100593 WP_002210062.1.10066 WP_002210062.1.100921 WP_002210062.1.100931 WP_002210062.1.10105 WP_002210062.1.101305 WP_002210062.1.101382 WP_002210062.1.101928 WP_002210062.1.102012 WP_002210062.1.102067 WP_002210062.1.10736 WP_002210062.1.10935 WP_002210062.1.10955 WP_002210062.1.11693 WP_002210062.1.12167 WP_002210062.1.12463 WP_002210062.1.12736 WP_002210062.1.12857 WP_002210062.1.1388 WP_002210062.1.14063 WP_002210062.1.14169 WP_002210062.1.14804 WP_002210062.1.15321 WP_002210062.1.15555 WP_002210062.1.15605 WP_002210062.1.15689 WP_002210062.1.16243 WP_002210062.1.16333 WP_002210062.1.17135 WP_002210062.1.17141 WP_002210062.1.17608 WP_002210062.1.17873 WP_002210062.1.17983 WP_002210062.1.18208 WP_002210062.1.18640 WP_002210062.1.18826 WP_002210062.1.19329 WP_002210062.1.19425 WP_002210062.1.19739 WP_002210062.1.19763 WP_002210062.1.20035 WP_002210062.1.20380 WP_002210062.1.20547 WP_002210062.1.2064 WP_002210062.1.20932 WP_002210062.1.21486 WP_002210062.1.21784 WP_002210062.1.21879 WP_002210062.1.21934 WP_002210062.1.22530 WP_002210062.1.22542 WP_002210062.1.22708 WP_002210062.1.23157 WP_002210062.1.23271 WP_002210062.1.23687 WP_002210062.1.23811 WP_002210062.1.24002 WP_002210062.1.2451 WP_002210062.1.24517 WP_002210062.1.25181 WP_002210062.1.25394 WP_002210062.1.26383 WP_002210062.1.2640 WP_002210062.1.26509 WP_002210062.1.26776 WP_002210062.1.26960 WP_002210062.1.27124 WP_002210062.1.27251 WP_002210062.1.2726 WP_002210062.1.28647 WP_002210062.1.28922 WP_002210062.1.29157 WP_002210062.1.29186 WP_002210062.1.29355 WP_002210062.1.2947 WP_002210062.1.29622 WP_002210062.1.2964 WP_002210062.1.29685 WP_002210062.1.29814 WP_002210062.1.3092 WP_002210062.1.30931 WP_002210062.1.311 WP_002210062.1.31336 WP_002210062.1.31496 WP_002210062.1.31721 WP_002210062.1.31739 WP_002210062.1.31805 WP_002210062.1.32343 WP_002210062.1.32388 WP_002210062.1.32446 WP_002210062.1.32736 WP_002210062.1.33203 WP_002210062.1.33324 WP_002210062.1.33661 WP_002210062.1.33775 WP_002210062.1.33937 WP_002210062.1.34031 WP_002210062.1.34138 WP_002210062.1.35389 WP_002210062.1.35538 WP_002210062.1.36088 WP_002210062.1.37174 WP_002210062.1.37494 WP_002210062.1.37863 WP_002210062.1.38147 WP_002210062.1.38235 WP_002210062.1.38532 WP_002210062.1.38743 WP_002210062.1.38824 WP_002210062.1.38993 WP_002210062.1.39066 WP_002210062.1.39346 WP_002210062.1.3976 WP_002210062.1.39858 WP_002210062.1.40071 WP_002210062.1.40134 WP_002210062.1.40534 WP_002210062.1.40853 WP_002210062.1.41196 WP_002210062.1.41984 WP_002210062.1.4210 WP_002210062.1.42361 WP_002210062.1.42490 WP_002210062.1.42976 WP_002210062.1.44408 WP_002210062.1.44598 WP_002210062.1.44603 WP_002210062.1.44832 WP_002210062.1.45198 WP_002210062.1.45214 WP_002210062.1.46262 WP_002210062.1.46545 WP_002210062.1.46686 WP_002210062.1.46697 WP_002210062.1.46731 WP_002210062.1.4678 WP_002210062.1.46891 WP_002210062.1.47387 WP_002210062.1.47440 WP_002210062.1.47769 WP_002210062.1.47881 WP_002210062.1.48166 WP_002210062.1.48722 WP_002210062.1.4889 WP_002210062.1.49315 WP_002210062.1.49906 WP_002210062.1.4997 WP_002210062.1.50010 WP_002210062.1.50093 WP_002210062.1.50106 WP_002210062.1.50185 WP_002210062.1.50984 WP_002210062.1.51284 WP_002210062.1.51293 WP_002210062.1.51588 WP_002210062.1.51772 WP_002210062.1.51934 WP_002210062.1.52158 WP_002210062.1.52473 WP_002210062.1.52569 WP_002210062.1.52734 WP_002210062.1.52792 WP_002210062.1.52819 WP_002210062.1.52969 WP_002210062.1.53147 WP_002210062.1.53300 WP_002210062.1.53838 WP_002210062.1.53848 WP_002210062.1.53883 WP_002210062.1.53953 WP_002210062.1.54568 WP_002210062.1.54951 WP_002210062.1.55194 WP_002210062.1.55695 WP_002210062.1.5592 WP_002210062.1.56031 WP_002210062.1.56912 WP_002210062.1.56953 WP_002210062.1.57585 WP_002210062.1.57657 WP_002210062.1.58067 WP_002210062.1.58543 WP_002210062.1.58794 WP_002210062.1.59102 WP_002210062.1.59431 WP_002210062.1.5957 WP_002210062.1.59635 WP_002210062.1.5968 WP_002210062.1.59687 WP_002210062.1.59789 WP_002210062.1.59885 WP_002210062.1.60707 WP_002210062.1.60896 WP_002210062.1.61689 WP_002210062.1.62232 WP_002210062.1.62342 WP_002210062.1.6270 WP_002210062.1.6333 WP_002210062.1.63387 WP_002210062.1.63517 WP_002210062.1.63641 WP_002210062.1.64142 WP_002210062.1.64474 WP_002210062.1.64780 WP_002210062.1.64786 WP_002210062.1.64910 WP_002210062.1.653 WP_002210062.1.65400 WP_002210062.1.65554 WP_002210062.1.6570 WP_002210062.1.65706 WP_002210062.1.65718 WP_002210062.1.6581 WP_002210062.1.66118 WP_002210062.1.66546 WP_002210062.1.66616 WP_002210062.1.67404 WP_002210062.1.67850 WP_002210062.1.6791 WP_002210062.1.68361 WP_002210062.1.68371 WP_002210062.1.68753 WP_002210062.1.68855 WP_002210062.1.69018 WP_002210062.1.69316 WP_002210062.1.69951 WP_002210062.1.70117 WP_002210062.1.70171 WP_002210062.1.70319 WP_002210062.1.70377 WP_002210062.1.70417 WP_002210062.1.70726 WP_002210062.1.7083 WP_002210062.1.7169 WP_002210062.1.71744 WP_002210062.1.72280 WP_002210062.1.72440 WP_002210062.1.72486 WP_002210062.1.7402 WP_002210062.1.74131 WP_002210062.1.74310 WP_002210062.1.74577 WP_002210062.1.74738 WP_002210062.1.75169 WP_002210062.1.75173 WP_002210062.1.7518 WP_002210062.1.75208 WP_002210062.1.75337 WP_002210062.1.75407 WP_002210062.1.75636 WP_002210062.1.75689 WP_002210062.1.75821 WP_002210062.1.76670 WP_002210062.1.77295 WP_002210062.1.77387 WP_002210062.1.77429 WP_002210062.1.77569 WP_002210062.1.77691 WP_002210062.1.78004 WP_002210062.1.7841 WP_002210062.1.78556 WP_002210062.1.7939 WP_002210062.1.79515 WP_002210062.1.79550 WP_002210062.1.79609 WP_002210062.1.79825 WP_002210062.1.79981 WP_002210062.1.8009 WP_002210062.1.80331 WP_002210062.1.81848 WP_002210062.1.81877 WP_002210062.1.8210 WP_002210062.1.82133 WP_002210062.1.82151 WP_002210062.1.82270 WP_002210062.1.82436 WP_002210062.1.82619 WP_002210062.1.8303 WP_002210062.1.83039 WP_002210062.1.83265 WP_002210062.1.83630 WP_002210062.1.8420 WP_002210062.1.84703 WP_002210062.1.84720 WP_002210062.1.85269 WP_002210062.1.85270 WP_002210062.1.8559 WP_002210062.1.85802 WP_002210062.1.86034 WP_002210062.1.86059 WP_002210062.1.86413 WP_002210062.1.87107 WP_002210062.1.87418 WP_002210062.1.8762 WP_002210062.1.87853 WP_002210062.1.87988 WP_002210062.1.88362 WP_002210062.1.88472 WP_002210062.1.89359 WP_002210062.1.89542 WP_002210062.1.8964 WP_002210062.1.90176 WP_002210062.1.9051 WP_002210062.1.90624 WP_002210062.1.91263 WP_002210062.1.91373 WP_002210062.1.91844 WP_002210062.1.92030 WP_002210062.1.92331 WP_002210062.1.92604 WP_002210062.1.927 WP_002210062.1.9311 WP_002210062.1.9320 WP_002210062.1.93623 WP_002210062.1.93928 WP_002210062.1.93933 WP_002210062.1.94052 WP_002210062.1.94201 WP_002210062.1.94545 WP_002210062.1.94683 WP_002210062.1.95746 WP_002210062.1.95981 WP_002210062.1.97245 WP_002210062.1.97375 WP_002210062.1.97448 WP_002210062.1.97791 WP_002210062.1.97864 WP_002210062.1.97872 WP_002210062.1.97894 WP_002210062.1.99109 WP_002210062.1.99383 WP_002210062.1.9941 WP_002210062.1.99416 WP_002210062.1.99788 WP_002210062.1.99882 WP_002210062.1.99972 WP_002210062.1.99990 YP_002348540.1.25044 214092.YPO3655 273123.YPTB3576 349747.YpsIP31758_0386 360102.YPA_3667 377628.YPN_3517 386656.YPDSF_0261 502800.YPK_0453 502801.YPTS_3764 gi|186897062|ref|YP_001874174.1| gi|51597867|ref|YP_072058.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]