SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|190576460|ref|YP_001974305.1| from Stenotrophomonas maltophilia K279a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|190576460|ref|YP_001974305.1|
Domain Number 1 Region: 34-129
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00000575
Family Apolipoprotein 0.0039
Further Details:      
 
Domain Number 2 Region: 126-244
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0000863
Family Apolipoprotein A-I 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|190576460|ref|YP_001974305.1|
Sequence length 519
Comment RmuC family protein [Stenotrophomonas maltophilia K279a]
Sequence
MQTEYLLIGGLLLAVLILQLVALLRRPPHDRLEQAVREEARAGRSELREQLDGFARALTD
LSTRTDQRLDLLREALGEDARKARAEAAESQQRGAALMGQRLQELRGQLETFGQQQEARI
HAFGQQLQELTGRTDTQLGALRQTLVDDARKGREEGAQSQQRLTESLGLRLQELTQRNEQ
RIAEMRATLEEQLRALQNDNAQKLEQMRHTVDEKLQSTLETRLGNSFKLVSERLEQVQRG
LGEMQQLATGVGDLKRVLTNVKNRGSWGEVQLENILEQTLTQEQYARAVKVRPDSGEMVD
IAVRLPGRSSDDTPVWLPIDSKFPREDYERLLDAQEQGDAEGVRLQGIQLERAVRVQAKS
ICDKYIAPPHTTDFAVMFLPTEGLYAEVIRRPGLVDLLQREHRVVVAGPTTVTALLNSLQ
MGFRTLAIEQRSSEVWSLLGAVKSEFGKFAGILEKAEKQITTVGRSIGEASRKTRTIERR
LRGVESLASEQAQSLLGGLADADATAEDEGNEGDDGDEA
Download sequence
Identical sequences A0A2J0TU40 B2FP90 J7V770
gi|190576460|ref|YP_001974305.1| WP_005411712.1.16506 WP_005411712.1.2396 WP_005411712.1.25576 WP_005411712.1.27790 WP_005411712.1.34786 WP_005411712.1.37169 WP_005411712.1.4992 WP_005411712.1.51731 WP_005411712.1.53081 WP_005411712.1.61049 WP_005411712.1.6195 WP_005411712.1.65590 WP_005411712.1.72571 WP_005411712.1.73044 WP_005411712.1.7336 WP_005411712.1.80113 WP_005411712.1.81009 WP_005411712.1.82179 WP_005411712.1.83038 WP_005411712.1.85246 WP_005411712.1.8701 WP_005411712.1.96606 WP_005411712.1.98612 522373.Smlt4678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]