SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|482890193|ref|YP_007887356.1| from Propionibacterium acnes HL096PA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482890193|ref|YP_007887356.1|
Domain Number 1 Region: 9-251
Classification Level Classification E-value
Superfamily SIS domain 8.23e-67
Family mono-SIS domain 0.000000745
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|482890193|ref|YP_007887356.1|
Sequence length 304
Comment N-acetylmuramic acid-6-phosphate etherase [Propionibacterium acnes HL096PA1]
Sequence
MDSLTNLATTEGRNPASEELDQLPTLDVLRLMNDEDHRVPDAIASQLSAIAAVVEAAVKG
LSAGGRLIYAGAGTSGRLGVLDAAECPPTFSTNPTMVVGLIAGGQQAMFQAVEGAEDDAD
RGAEELNMLQPGPHDVVVGLAASGRTPWVLGVVRAAKRAGAVTASVCCNHRAVISSEVDL
PVEIDAGPEVLTGSTRLKAGTAQKLVLNMISTATMVGLGKTYGNLMVDVSPSNEKLRQRA
MSIVMAATGCSCDDAITALHEAGGHAKTAIVMVLLGMTATQARARLAEAGGVVRVAVDEN
HLRL
Download sequence
Identical sequences A0A0E1YGQ6 A0A2B7J2T4 D4HDU8 F1UHF0
WP_002516618.1.102131 WP_002516618.1.14952 WP_002516618.1.17969 WP_002516618.1.18145 WP_002516618.1.20232 WP_002516618.1.23000 WP_002516618.1.2563 WP_002516618.1.26091 WP_002516618.1.27635 WP_002516618.1.2928 WP_002516618.1.29382 WP_002516618.1.29850 WP_002516618.1.30003 WP_002516618.1.31063 WP_002516618.1.31800 WP_002516618.1.33260 WP_002516618.1.34331 WP_002516618.1.36413 WP_002516618.1.38538 WP_002516618.1.40065 WP_002516618.1.41101 WP_002516618.1.41264 WP_002516618.1.41273 WP_002516618.1.41331 WP_002516618.1.42227 WP_002516618.1.43983 WP_002516618.1.48475 WP_002516618.1.49524 WP_002516618.1.50378 WP_002516618.1.56110 WP_002516618.1.56441 WP_002516618.1.56826 WP_002516618.1.57145 WP_002516618.1.57563 WP_002516618.1.58125 WP_002516618.1.59962 WP_002516618.1.60466 WP_002516618.1.60649 WP_002516618.1.62864 WP_002516618.1.66193 WP_002516618.1.70135 WP_002516618.1.70496 WP_002516618.1.7197 WP_002516618.1.73086 WP_002516618.1.73414 WP_002516618.1.74417 WP_002516618.1.74916 WP_002516618.1.7599 WP_002516618.1.76554 WP_002516618.1.76841 WP_002516618.1.80187 WP_002516618.1.821 WP_002516618.1.82350 WP_002516618.1.83430 WP_002516618.1.86359 WP_002516618.1.90730 WP_002516618.1.91146 WP_002516618.1.97839 WP_002516618.1.98214 WP_002516618.1.99435 gi|386024085|ref|YP_005942390.1| gi|482890193|ref|YP_007887356.1| gi|295130699|ref|YP_003581362.1| gi|407935536|ref|YP_006851178.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]