SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|482890770|ref|YP_007887933.1| from Propionibacterium acnes HL096PA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482890770|ref|YP_007887933.1|
Domain Number 1 Region: 57-332
Classification Level Classification E-value
Superfamily SIS domain 1.09e-36
Family mono-SIS domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|482890770|ref|YP_007887933.1|
Sequence length 339
Comment hypothetical protein PAGK_1616 [Propionibacterium acnes HL096PA1]
Sequence
MTFDDSRLDAPLDALAERVLRQLASTGARIRRDSADLDEVRRTVGEWGQPRGVLVVGPEA
RLVRSVLEPICPVPLVAWPFLRLPAWVGPLDLVVALDSDGHCAAQVAEARRRGSAIIMTS
TGETESWQAAGSHGTARIQMASEDALSAAVAALSVLSDLGLGPVVDPGQVARVADMVAES
ASPHHDLAVNEAKDLACALADAEPLLWGGSVLAARASRRLAQWMRRATGRIALSADSAAL
RPVIDSAPKRDPFADPDLDGETRRPVLVVMDDAEMEHAAARRDLEQLCAAHDVTVRSVTL
PLGIDEQSSPMSRYVALLLQGSFAAVYVALGLDRLKEMT
Download sequence
Identical sequences A0A1J4X4D1 A0A2B7I5B5 D4H993 F1UKY7 W4TYJ0
gi|386024629|ref|YP_005942934.1| WP_002516149.1.102131 WP_002516149.1.15006 WP_002516149.1.1505 WP_002516149.1.18145 WP_002516149.1.20232 WP_002516149.1.23000 WP_002516149.1.2563 WP_002516149.1.26091 WP_002516149.1.27635 WP_002516149.1.2928 WP_002516149.1.29382 WP_002516149.1.29850 WP_002516149.1.30003 WP_002516149.1.31063 WP_002516149.1.3171 WP_002516149.1.31800 WP_002516149.1.33260 WP_002516149.1.34331 WP_002516149.1.36413 WP_002516149.1.38538 WP_002516149.1.40065 WP_002516149.1.41101 WP_002516149.1.41264 WP_002516149.1.41273 WP_002516149.1.41331 WP_002516149.1.42227 WP_002516149.1.43983 WP_002516149.1.48475 WP_002516149.1.49524 WP_002516149.1.50375 WP_002516149.1.50378 WP_002516149.1.51523 WP_002516149.1.53219 WP_002516149.1.54292 WP_002516149.1.56110 WP_002516149.1.56826 WP_002516149.1.57145 WP_002516149.1.57563 WP_002516149.1.58125 WP_002516149.1.59962 WP_002516149.1.60466 WP_002516149.1.60649 WP_002516149.1.60667 WP_002516149.1.61734 WP_002516149.1.62864 WP_002516149.1.66193 WP_002516149.1.67247 WP_002516149.1.70496 WP_002516149.1.7197 WP_002516149.1.73086 WP_002516149.1.73414 WP_002516149.1.74417 WP_002516149.1.7599 WP_002516149.1.76554 WP_002516149.1.767 WP_002516149.1.76841 WP_002516149.1.7771 WP_002516149.1.80187 WP_002516149.1.821 WP_002516149.1.82350 WP_002516149.1.83430 WP_002516149.1.86359 WP_002516149.1.87452 WP_002516149.1.90730 WP_002516149.1.91146 WP_002516149.1.91610 WP_002516149.1.92292 WP_002516149.1.97417 WP_002516149.1.97839 WP_002516149.1.98214 WP_002516149.1.99435 gi|295131210|ref|YP_003581873.1| gi|482890770|ref|YP_007887933.1| gi|407936075|ref|YP_006851717.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]