SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186680629|ref|YP_001863825.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186680629|ref|YP_001863825.1|
Domain Number 1 Region: 345-545
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.21e-41
Family Nitrogenase iron protein-like 0.00000164
Further Details:      
 
Domain Number 2 Region: 241-318
Classification Level Classification E-value
Superfamily Domain of the SRP/SRP receptor G-proteins 0.00000000000000222
Family Domain of the SRP/SRP receptor G-proteins 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186680629|ref|YP_001863825.1|
Sequence length 547
Comment signal recognition particle-docking protein FtsY [Nostoc punctiforme PCC 73102]
Sequence
MVFNWFRRQYNDSSETPSDKKQEETTPAQEPQPEPAETSTAETAPDTTADLLAFAKAAYK
NIQQKQQTEVVETPPDSENASAEPETVETAIAEITESELIDEPVSTTLETAQPEIIQTAT
EEENTEDSSVIAIAEEPDVESSEITTNEIEQTRTPEATQPTAPANLSFLERAAAERQAKL
DQLIATAIEVPEPEVVQPVAATSEIGEEIPGLVFDDGFVWSAKVLAAQGRNPEDVSIEEI
TWLKKLRQGLDKTRRSILNQLKAIVGQGPLNQAAVTEIEALLLQADVGVEATDFIINALQ
TKLREEVTAPEEAIAYLKKILRDMLDAPSIASHKTSFTPEKETLNIWLITGVNGAGKTTT
IGKIAHLGQKSGYKCLIGAADTFRAAAVEQVKVWGSRSGVEVIANPGKNTDPAAVVFDAI
AAAQSRQTELLLVDTAGRLQNKKNLMDELGKIRRIIDKKAPNAKVESLLVLDATLGQNGL
RQAEVFSQAAQLSGVVLTKLDGTAKGGVALAVVQQLGLPIRFIGAGEGIEDLRPFSSYEF
VEALLSS
Download sequence
Identical sequences B2J3F2
WP_012406911.1.44837 63737.Npun_F0081 gi|186680629|ref|YP_001863825.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]