SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186680848|ref|YP_001864044.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|186680848|ref|YP_001864044.1|
Domain Number - Region: 65-138
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00301
Family Collagen-binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186680848|ref|YP_001864044.1|
Sequence length 143
Comment hypothetical protein Npun_R0316 [Nostoc punctiforme PCC 73102]
Sequence
MKTLRLLAILPISLVMSLVFTEANLAQIPNVQINRTFQPDPLVLNGKSGGTVKSNCGNIT
TEPSQVIQVTESLPYLRLTVESQGKPTLLIDGPGGRFCVMADSYSGGKPEQSGYWQAGRY
SVYVGELSQQQHNYSLSISQHNK
Download sequence
Identical sequences B2J5T5
WP_012407127.1.44837 gi|186680848|ref|YP_001864044.1| 63737.Npun_R0316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]