SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186681400|ref|YP_001864596.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186681400|ref|YP_001864596.1|
Domain Number 1 Region: 86-337
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.69e-16
Family Nucleotide and nucleoside kinases 0.077
Further Details:      
 
Weak hits

Sequence:  gi|186681400|ref|YP_001864596.1|
Domain Number - Region: 13-51
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.0157
Family KorB DNA-binding domain-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186681400|ref|YP_001864596.1|
Sequence length 666
Comment hypothetical protein Npun_R0916 [Nostoc punctiforme PCC 73102]
Sequence
MAERGLKASTEGIAKANQALIRNSLNKAALARDLGLSRATVTNFFRVIPIDRLNFEEICK
GLGLNWQEIVDIRVGKSQTEKHQNPTSKNYDFVGREDAIAHLNNLVNEGAKVILIQAEGG
IGKTTLAKKWFELQGLEYLELRVGSTPQNLNSVEDWLRVKLRDYFKDNPEENFMIMLEQL
KTQLQIRKIGVLIDNLEPALINGKLIEPQHSYYVELLTVLAHHSVQSVTLITSREQIDEH
TLKRLQTFQSYTIEGLKQEVWRQYFEICNINIDSDALREMHQAYGGNAEVMYILSGDIVT
TSKGDLKYFWKKNCDYLLINSTLENLVQYQFDKLQRDNPQVYKLLCRLGCYRYQYVSIIP
EEGIFYLLWDEQKERDKLKLLRGLKNRALVKFSEEGCYLYEVIREEAIQRLKLTNDWKQC
HTEAGIFLSTLISNSCQTIIPKITCIKVNDTQEQTYLNIENAKIAVKQGLSKQETIALEV
VYHVMEFYGVGCFEELRQEPKVLDNPFFKAIENMVFEYVDCYSNLGLVLYKFALSTQVLG
IIDEIEENFIASSKEFEYYQRSLKVSQCFFQTALLMATKVKEDKLMIKLIQYLAECQDFT
GMFLYQITKNNESTEAFDKIKVNLEKLVQRFDKLSFEQKSEEVKQAIHSLRINEQYYSKF
IATFLT
Download sequence
Identical sequences B2IU82
gi|186681400|ref|YP_001864596.1| 63737.Npun_R0916 WP_012407675.1.44837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]