SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186681611|ref|YP_001864807.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186681611|ref|YP_001864807.1|
Domain Number 1 Region: 77-93,130-191,221-444
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 1.6e-42
Family Nitrous oxide reductase, N-terminal domain 0.013
Further Details:      
 
Weak hits

Sequence:  gi|186681611|ref|YP_001864807.1|
Domain Number - Region: 697-876
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 0.00523
Family Arylsulfatase 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186681611|ref|YP_001864807.1|
Sequence length 1007
Comment hypothetical protein Npun_F1138 [Nostoc punctiforme PCC 73102]
Sequence
MVTNKNQGYLLSLLLLSTLGANIQSASARTTSPVGNLQGGAALLPTGQIITPAAAPGSTF
APLATGLRTDDNADAAEAVSTALSPDGKTLLVLTSGYNQNFKNENTGSNFTYPVLDPQTG
KSSGTTTRKAEWVFVYDVSSGKLVKRQQINIPNTYNGLAWAKDGSRFFVSGGIDDRVYVY
ASNGSQYVPDAPFILLGHNSNQTDPFPKYDGGLLKDTPAKAVATGAVVAGIAVSKDGRTL
VTANFENDSISIVDATTRKVTKEIKFFRPGDKIATGEFPFDVAIKSAENGQAAKVFISSQ
RDNEVLAVAITSGQITRIPIGSQPNKVLLSPSQNRLYVANGNDDSISVIDTDSNRVVRTI
SLSRPGDRYKGANPNSLALSPDGATLYVTLGGENAVAVVDLQSSRVNGRIPTGWYPNSVS
VSQDGQRLYVVNAKSNSGPNPAGNLTTPAGLARNTNFKNEYNWALEKAGISIIPVPKGAT
LGTLSAQVDKNNGFYNRRPDRTMRYLQGKIKHVIYIVKENRTYDQVLGDLPLGNGDPTLT
LFPNNISPNHHKLSFGFATFDNFYDSGESSGVGWSWSTFARTTDYTEKTQSVLYGNAGFN
GLTYDYEGTNRNISLALPQTSSNASPINTRLTGILDRSGRSSILPGDRDVNAPEGDGDLG
IDVIGGYLWDAALRAGKTVRNYGFLVDNGAPYITSQPDPTKPDPQNPAYIPISPNPYADK
IPQAPVTKTVLLDKTDLYFRSFDMNNPDIYLYNEWARDIEQNGLPNLMLVRLPHDHFGSF
GTALAGLNTPQLQMADNDYAIGKLVEKISHLPEWKETAIFIIEDDSQNGPDHVDSHRSLA
YVISPYTKRGALVSTNYNTINVLRTMEDLLNIGYLAITDANAEPMSDAFTREPNFEPYTA
VVPGNLCANPVDPKLVPACQDQNVEKTAAMPILNDKSWWAAMTKDFNFVGEDNLDPEEFN
EILWAGIKGDSIPYPEERNRQDLRQNRAQVLKNWQLSERNNSTEAKK
Download sequence
Identical sequences B2IWB9
WP_012407885.1.44837 gi|186681611|ref|YP_001864807.1| 63737.Npun_F1138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]