SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186681625|ref|YP_001864821.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186681625|ref|YP_001864821.1|
Domain Number 1 Region: 40-123,206-329
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.67e-19
Family G proteins 0.057
Further Details:      
 
Domain Number 2 Region: 400-506
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0000902
Family Apolipoprotein 0.0094
Further Details:      
 
Weak hits

Sequence:  gi|186681625|ref|YP_001864821.1|
Domain Number - Region: 431-712
Classification Level Classification E-value
Superfamily ARM repeat 0.0224
Family Regulatory subunit H of the V-type ATPase 0.07
Further Details:      
 
Domain Number - Region: 707-770
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0955
Family Apolipoprotein A-I 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186681625|ref|YP_001864821.1|
Sequence length 815
Comment hypothetical protein Npun_R1152 [Nostoc punctiforme PCC 73102]
Sequence
MSDLPLQCKNLKEQVESILQLLQQEPTLHFQDITPVQTSLTKAISPKFEIVFAGAFSAGK
SMLINALLERELLYSAEGHATGTECKIEYAEVDKERVVLTFLSEAEIREQAVYLCQQLGF
TTVTNINQADVITLLRQGSEAIIQQEGGESKSERAKQAKALMLLVEGYIANRDRINTVNN
ATYSMEQFNFSNLKEAAGYARRGSNSAVLKRIEYYCNHPLLEDGNVIIDTPGIDAPVEKD
AQLTYAKIQHPDTSAVVCVLKPAAAGDMTKEETELLELMRQNGGVRDRVFYVFNRIDETW
YNTQLRQRLDDLISGQFANSNKVYKTSGLLGFYGSQIKQTNQLDRFGLDSVFAESIKGLD
GKEETPQFVYAFNNYCVNSGKLSTTKFRVSVNGYETPNQNYVRILGDWGNELIEKLIQDS
GTEEFRTAITRYLTEEKRPQLFKNLADDLEDVCIKLKKHYQSVQRNLDSQPQEIESMKVQ
ELQRLNQQLQQVGREFSEHITEEVNQIINNSCDAFEVDFRQLQSRMIRRLDELLDTFSVA
SAYQRATISHPRNATAPLIAILVEAFYYLANQLEDILIESSQQVVTNYFQRLIEKIRKSE
YYRQLYRLLDNDGGIEQEIRNLEKGVTQALVSAASVECDRFVRESPRFYDEGTFSIYQFR
QTLLQTSQGYDAESIVEAEPAIRQLLKLDFEPKVSHTIRKSFRQTINQTLKTQLLPMAEQ
QADEILQQYPQARAYLEKTLQQEAEEKIANNRRLLSVVEENIAAYNSAVSSINSCLQSMK
LYDRFLPTIGDSFDADDKFTNNGFVVSDAMQEVEY
Download sequence
Identical sequences B2IWD3
63737.Npun_R1152 gi|186681625|ref|YP_001864821.1| WP_012407899.1.44837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]