SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186681715|ref|YP_001864911.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186681715|ref|YP_001864911.1|
Domain Number 1 Region: 28-108
Classification Level Classification E-value
Superfamily SH2 domain 0.0000674
Family SH2 domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186681715|ref|YP_001864911.1|
Sequence length 126
Comment hypothetical protein Npun_R1245 [Nostoc punctiforme PCC 73102]
Sequence
MDKQHRYLQIALVVVGIAFLLIYPLMNIWPSGWSWQPGQHEYEQMIVGIYGTLGVFLLRA
SREPEAHLSLIWFTVWSSFVHALIMAVQAVIDPVEHGHFFGDIPALILVAIVLGFLASRE
VVSVHE
Download sequence
Identical sequences B2IXE6
63737.Npun_R1245 WP_012407989.1.44837 gi|186681715|ref|YP_001864911.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]