SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186682177|ref|YP_001865373.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186682177|ref|YP_001865373.1|
Domain Number 1 Region: 296-494
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 4.84e-48
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000181
Further Details:      
 
Domain Number 2 Region: 822-1017
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 5.75e-44
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000575
Further Details:      
 
Domain Number 3 Region: 40-133
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.27e-20
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.002
Further Details:      
 
Domain Number 4 Region: 137-182,273-329
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 3.31e-19
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0079
Further Details:      
 
Domain Number 5 Region: 712-798
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 2.22e-18
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0022
Further Details:      
 
Domain Number 6 Region: 561-661
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.41e-18
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.01
Further Details:      
 
Domain Number 7 Region: 183-264
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00000000000000379
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0025
Further Details:      
 
Domain Number 8 Region: 670-711,798-846
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00000000000149
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186682177|ref|YP_001865373.1|
Sequence length 1041
Comment acriflavin resistance protein [Nostoc punctiforme PCC 73102]
Sequence
MNLSELFIRRPVMTTLVMMGILIFGLMSYLLLPISALPNVEYPFISVSASLPGATPETMA
SSVAAPLERQFTEIAGLNSFNSTSSTGSTNISLQFDFSRRVEDAAKDVQAAISAAAGQLP
AGMPHPPTYRKVNPSVSPVLYLYMYSETQPISTVDEYAEVTVGQPISMINGVAQVQVFGQ
QQYAVRVQLDPRELASRGIGLTQVKTAIQQGNVNLPTGSLSGTYKSYTIQANGQLTDAAS
YRQLIVTYKNGATVRLQDLGQIIDSEQNVKVSNLYSDRKVTNRHSVVLAVQPQPGANTVN
IVDAIQELLPTLREQVPKSIEMGIMYDRSQTIRASVNDVKFTLVLSVCLVVLVIFLFLRD
ITATLIPSLALPVAIIGTFAVMYLSGFSLDNLSLMALTLSVGFVVDDAIVVLENIVRYRE
MGESPLNAALKGSREISFTILSMTLSLVAVFIPIMFMSGIIGKLFHEFAVTIAVAILVSG
FVSLSLTPMLCSRFLSSSHQQRPNRLYRVSERAFDLLLRGYDWTLKPVLKYRLMTLIGSG
ILLVMTVYLFVIVPKGFIPTEDTGQLMANTKGAQDISFDDMRHHQQKVVDLIRQDPNIEA
VDSIVGASGPNASVNSGRITIRLKPRSQRKLSADEIIQELTPKLRRVVGVKTFLRSPPAI
PIGGQQTNSTYQFTLQSLNLQDLRQYVPKLVDKVKTLPGLQNVDSDLQLSTPQIQVKFDH
NKAATLGITAQQVEQTLSTAYGSSQVSTIYTPNDQFYVILEVKPEFQRDSTALSMLYVQS
STGKLVPLSAIANITQNVGPLTVTHVAQLPSATISFDTLAGTSLSQATDAIKQAASEVLP
STITTSFQGSAQTFQQSFNDLGVLLLVSILVIYLILGILYEDFIHPITILSGLPSAGFGA
LLTLLIFQVDLNLYSFIGIILLVGIVKKNGIMLVDFAIEAQRKEGKNSFDTIYAACLIRF
RPIMMTTMAALIGTLPIALGTGVGSEARRPLGIAIVGGLLFSQILTLYLTPVFYIYMEAL
RKKLSIQPKKAEKKHLPAVKS
Download sequence
Identical sequences B2J2J9
gi|186682177|ref|YP_001865373.1| 63737.Npun_R1768 WP_012408448.1.44837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]