SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186682642|ref|YP_001865838.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186682642|ref|YP_001865838.1|
Domain Number 1 Region: 4-172
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 5.36e-32
Family Isochorismatase-like hydrolases 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186682642|ref|YP_001865838.1|
Sequence length 174
Comment isochorismatase hydrolase [Nostoc punctiforme PCC 73102]
Sequence
MSEILLVVDMQNGFMSEKCRHIIPSVIKLIERFLATGKLVEFTRFINTTDSNYVKLIQWS
RLINEPETSIIDELQPYINNIFDKHYYSAFTENFSAFIFLNQISKIYLCGVETDSCLFKT
AIDSFERGIEPVIIEDACFSDGGQQAHDAGIFLLKRNIGKNQIQMTDDILEKML
Download sequence
Identical sequences B2J7G0
63737.Npun_R2309 gi|186682642|ref|YP_001865838.1| WP_012408892.1.44837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]