SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186683111|ref|YP_001866307.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186683111|ref|YP_001866307.1|
Domain Number 1 Region: 388-510,753-817
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 4.32e-47
Family Intein (protein splicing domain) 0.0000809
Further Details:      
 
Domain Number 2 Region: 189-373,812-874
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.75e-42
Family RecA protein-like (ATPase-domain) 0.025
Further Details:      
 
Domain Number 3 Region: 14-126
Classification Level Classification E-value
Superfamily N-terminal domain of DnaB helicase 1.31e-32
Family N-terminal domain of DnaB helicase 0.00021
Further Details:      
 
Domain Number 4 Region: 587-700
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0000000000000017
Family Intein endonuclease 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186683111|ref|YP_001866307.1|
Sequence length 876
Comment replicative DNA helicase [Nostoc punctiforme PCC 73102]
Sequence
MAEELNFKGDGSDRLPPQNIEAEEAILGGILLDPEAISRVSDRLLPEAFYISAHKDIYQA
AVRLHTQGKPTDLLSVTSWLTDHEMLTRIGGRNKLATLVDRTVSAVNIDALAGLVMEKYL
RRQLIKAGNEIVHLGYETETELPTVLDQAEQKVFGVTQERPQSGLIHISDTLINNFQDIE
DRNQGIALPGVPCGFYDLDAMTSGFQRSDLIIVAGRPSMGKTAFCLNLAHNIAASYKLPV
AFFSLEMSKEQLTQRLLASEAQIESSYLRTGRLSQTQWEPLSRAIGILSEMPIYIDDTPN
ITVTQMRSQARRLQAEVGTELGLIVIDYLQLMEGAGDNRVQELSKITRQLKGLARELSVP
VIALSQLSRGVEARTNKRPMLSDLRESGCLAGDSLVTLVDSGLQVPIKELVGKSGFAVWA
LNEATMQLEKAIVSNAFSTGIKPLFTLTTRLGRKIRATGNHKFLTINGWKRLDELTPKEH
LCLPRNLPSSGKQTMTYAEVALLGHLIGDGCTLPRHAIQYTTREIDLAQNVAFLATEVFG
DSIVPRISPEREWYQVYLSAAQHLTHSVRNPIAKWLDSLNVFGLRSYEKFVPRELFSQPK
ELIACFLRHLWSTDGCINLIAGKKPRPIAFYASSSERLAFDVQTLLLRLGINATLRTVPQ
VGKGRNQYHVIITGKPDLQLFIVHVGAVGQYKLRSLQDIFQHLENSIHNPNRDIIPKDIW
KMEVVPAMQAIGFTTRILQASIGVSYCGSTLYKVNLSRERALKVGNIVQSSKLVTLAKSD
VYWDEIVSIEYSGEEEVFDLTVPGLHNFVANNIIVHNSIEQDADLVIMLYRDEYYSPDTP
DRGIAEVIIAKHRNGPTGTAKLLFNPQFTKFQNLKI
Download sequence
Identical sequences B2IVH9
WP_012409357.1.44837 gi|186683111|ref|YP_001866307.1| 63737.Npun_F2831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]