SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186683146|ref|YP_001866342.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186683146|ref|YP_001866342.1|
Domain Number 1 Region: 9-696
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.79e-181
Family Neurolysin-like 0.000000423
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186683146|ref|YP_001866342.1|
Sequence length 703
Comment peptidase M3A and M3B, thimet/oligopeptidase F [Nostoc punctiforme PCC 73102]
Sequence
MSASTIISDNPLLQGVGLPPFAEIKPERVVPAFNQLLAELDQQLATLEASVQPTWSGLVE
PLEKLTERLTWSWGVVNHLMGVKNSPELREAHEIVQPLVVQFINKLGQSQPIYNAFKALR
TSENWATLELAQQRIVEAAIRDAELSGVGLEGEVRERFNAIQMELAELSTKFSNHVLDAT
KAFSLTLTTQAEIEGLPPSLVSLAAQVARAAGESNATPENGPWRITLDFPSYGPFMQHST
RRDLREKLYKAHITRASTGDLDNNPLIERILKLRQELADILGFKSFAQLSLASKMAPNVE
AVNALLEELRHASYDAAVKDLVELKAFAAAQGAAEAEDLKHWDISFWAERQREAKFAFTA
EELRPYFPLPQVLDGLFGLVKRLFGVTVTSADGQAPVWHEDVRYFQIADETGSPIAYFYL
DPYSRPAEKRGGAWMDVCINRAKITENGVTAIRLPVAYLVCNQSPPVDGKPSLMTFYEVE
TLFHEFGHGLHHLLTKVNYPGAAGINNVEWDAVELPSQFMENWCYERTTFFGMAKHYETG
EALPEHYYQKLLAARNYMSGTAMLRQIHLSSLDLELHYRYHPGSSETPSDVRHRIAKTTT
VLQPLPEDAILCAFGHIFEGGYAAGYYSYKWAEVLSADAFAAFEEAGLEDEEAIKATGRR
YRDTVLALGGGQHPMEVFKTFRGREPSTIALLRHNGLVSAAVN
Download sequence
Identical sequences B2IVL4
gi|186683146|ref|YP_001866342.1| WP_012409390.1.44837 63737.Npun_F2866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]