SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186683642|ref|YP_001866838.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186683642|ref|YP_001866838.1|
Domain Number 1 Region: 5-327
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 8.9e-49
Family Heme-dependent catalases 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186683642|ref|YP_001866838.1|
Sequence length 345
Comment hypothetical protein Npun_F3488 [Nostoc punctiforme PCC 73102]
Sequence
MMKTHHQIFMTNPTSSTTDQEAIIDEIIATSLQAQQKTGPDLRQIHSKSHGLLGGEFIIE
PNVPEDLRVGLFKKPQTYPAWIRFSSGGSPEKRGKFHSDSQPDVRGIAIKVMNVDGQKVL
DDEEKTQDFILNNYPIFLTKDVRDYADLSRAGSGQLSPERIQELGYAFAILQKIGSQKVV
NPLLIQYWSMAPFKFGNRIVRLSVKSQQPEQPPEKLPESENYLREAIVKYLTEEGKEASF
DFFIQFYVDDEKTPIEDHVKEWQEADSPFVKVATVRIFSQKFDFEERKRLDEGMLFSPWH
TLLDHEPVGSVNLSRKRLYSELAKYRREQIAQRLLEPQPYVAVED
Download sequence
Identical sequences B2J144
WP_012409869.1.44837 63737.Npun_F3488 gi|186683642|ref|YP_001866838.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]