SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186683799|ref|YP_001866995.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186683799|ref|YP_001866995.1|
Domain Number 1 Region: 3-153
Classification Level Classification E-value
Superfamily Bacterial fluorinating enzyme, N-terminal domain 0.0000011
Family Bacterial fluorinating enzyme, N-terminal domain 0.024
Further Details:      
 
Weak hits

Sequence:  gi|186683799|ref|YP_001866995.1|
Domain Number - Region: 163-225
Classification Level Classification E-value
Superfamily Bacterial fluorinating enzyme, C-terminal domain 0.00157
Family Bacterial fluorinating enzyme, C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186683799|ref|YP_001866995.1|
Sequence length 263
Comment hypothetical protein Npun_R3662 [Nostoc punctiforme PCC 73102]
Sequence
MFICVIADYGTGDPAFTEVTQRLLMAFPHAQIHLLSVPAFSTLATGFWIAQLGLNPGPSD
RLIYHNCAPRQDDPEARRDNEGEGLTYALLSNGVKVVGVNAGYTLSFIKDYTKELRVVNV
SRGGSQFRSRDVFPPAAAAIMNEDFSLLGDSLKSEQIPDVPPDRIAWIDGYGNIKTTIGA
HTLNLEPQSKIVIRIGDVVSDAVYSDGSFKVSEGTLAFAPGSSGWPTGDSGEPLRFLELF
LRGGSAWERFGRPRVNQQVTRIA
Download sequence
Identical sequences B2J2Y5
63737.Npun_R3662 WP_012410023.1.44837 gi|186683799|ref|YP_001866995.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]