SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186683802|ref|YP_001866998.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186683802|ref|YP_001866998.1|
Domain Number 1 Region: 59-269
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.93e-59
Family Anthrax toxin lethal factor, N- and C-terminal domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186683802|ref|YP_001866998.1|
Sequence length 274
Comment hypothetical protein Npun_F3665 [Nostoc punctiforme PCC 73102]
Sequence
MIQTIIAFLIIGLILTGILINPVLVKRRRNRLKYRPFPPLWNAIIENNLPIYLYLSPNEI
RRLQGHIQVFLAEKQFIGCRGLQVTEEMKLSIASVACLVLLNERGQYFPRLRSILVYPNA
YFVKETTSIGKYVVEERRVARLGESWTNDQLVLSWEQVKHDIDNWSDGRNVVLHEFAHQL
DQEDGKAEGVPILQSNSDYTIWAKVMTEEYQQLCNDVLQGAKTVMHSYGATNPAEFFAVA
TETFFEKPHQLLSKHPALYEQLQRYYQLDPGQWV
Download sequence
Identical sequences B2J2Y8
63737.Npun_F3665 WP_012410026.1.44837 gi|186683802|ref|YP_001866998.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]