SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186684112|ref|YP_001867308.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|186684112|ref|YP_001867308.1|
Domain Number - Region: 18-69
Classification Level Classification E-value
Superfamily PEBP-like 0.032
Family Prokaryotic PEBP-like proteins 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186684112|ref|YP_001867308.1|
Sequence length 293
Comment fatty acid desaturase [Nostoc punctiforme PCC 73102]
Sequence
MTANFGAFAKSVGEAIAPERGKSPQLSWTNVVFFTTFHALALMSPWFFSWSALGLLVFLH
WLFGSIGICLGYHRLLSHKSFQVPKWLEYAIALIGALALQGGPIFWVGGHRQHHAHTEDI
NLDPYSAQRGFWWSHILWIFYPRPEFFDYDTYKKYAPDLARQPFYCWLDRYFLLLQIPFA
LLLYGLGGWPFVFYGVFLRCVLLWHSTWFVNSASHLWGYRTFDANDGARNLWWVSLVTYG
EGWHNNHHTYPHMAKSGLSWWEIDVTWWSILVLQTLGLAKKVVSRPPQGATHG
Download sequence
Identical sequences B2J6G0
gi|186684112|ref|YP_001867308.1| WP_012410332.1.44837 63737.Npun_F3985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]