SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186684318|ref|YP_001867514.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186684318|ref|YP_001867514.1|
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily RbcX-like 5.1e-44
Family RbcX-like 0.00000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186684318|ref|YP_001867514.1|
Sequence length 135
Comment chaperonin family protein RbcX [Nostoc punctiforme PCC 73102]
Sequence
MNLKQIAKDTAKTLQSYLTYQALRTVLAQLGETNPPLELWLHNFSSGKIQNGESYIEQLL
REKPDLALRIMTVREHIAEEIAEFLPEMVRTGIQQANMEQRRQHLERITRIDTSNPSLQP
EQQTTSDQNLDNLSN
Download sequence
Identical sequences A0A023SF35 A0A023SHS9 A0A075QJP5 A0A075QTL4 A0A075QTM0 B2J8T3 M1RWH1 M1SZ90 M1SZD7 M1T014 M1T7A6 Q2LJA6 Q2LJK2
63737.Npun_F4196 WP_012410538.1.44837 359714 gi|186684318|ref|YP_001867514.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]