SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186684400|ref|YP_001867596.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186684400|ref|YP_001867596.1|
Domain Number 1 Region: 195-455
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.17e-23
Family Leukotriene A4 hydrolase catalytic domain 0.034
Further Details:      
 
Domain Number 2 Region: 460-563
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000644
Family PDZ domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186684400|ref|YP_001867596.1|
Sequence length 593
Comment peptidase M61 domain-containing protein [Nostoc punctiforme PCC 73102]
Sequence
MTEATATRPNAYIQETGPTIHYLVAMSQPETHLFEVTLRIVDYTSPILDLKLPVWTPGSY
LVREYAKNLQDFVVFAEDKPLPWRKISKNHWQVDKTGVSELTVRYRIFANELSVRTNHLD
ATHGYFNGAALFFRLPGWDKQPIRVTIVPPYPEWQVTTALPPVGEETNTFWASDFDTLVD
TPFEIGSHQLYKFEVLGKPHELAIWGKGNYQVQHMIADIQKIIQVEAQMFGGLPYERYVF
LLHLFSQAFGGLEHKDSCSLIYQRFGFRTQEKYDRFMQLVAHEFFHLWNVKRIRPKALEV
FDYDQENYTPSLWFCEGTTSYYDLLIPLRAGIYDIKSYLNNLSKEITRYETTPGRKVQPV
SESSFDAWIKLYRPDANSGNSQISYYLKGEMVSLLLDLLIRSTHDNQRSLDDVMLKMWQQ
FGKDEIGYTPEQLQEVIESVAGIDLTDFFKRYIDSTDDLPFNQYLEPFGLQLVAEQQEEP
YLGVRINTENGREMIKFVETDSPAQIGGIDAGDELLAIDGIKVTASSLSDRLKDYQANDT
IQVTVFHQDELRTYSITLASPHPTRYQVKPVERPNSTQQQNFAGWLGVAIATV
Download sequence
Identical sequences B2J9X6
WP_012410620.1.44837 63737.Npun_R4278 gi|186684400|ref|YP_001867596.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]