SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186684725|ref|YP_001867921.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186684725|ref|YP_001867921.1|
Domain Number 1 Region: 11-235
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.44e-34
Family Serralysin-like metalloprotease, catalytic (N-terminal) domain 0.0078
Further Details:      
 
Domain Number 2 Region: 356-518
Classification Level Classification E-value
Superfamily beta-Roll 4.19e-25
Family Serralysin-like metalloprotease, C-terminal domain 0.0005
Further Details:      
 
Domain Number 3 Region: 243-369
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000000824
Family Serralysin-like metalloprotease, C-terminal domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186684725|ref|YP_001867921.1|
Sequence length 522
Comment hemolysin-type calcium-binding region [Nostoc punctiforme PCC 73102]
Sequence
MARTTTLPVAQKPLTNNVYIDGILWGGKYYSSSGSSVTRIDYSFWNSTAASFDDPYKNKA
TNPNDWFPEGKDSLIKALDAWAAVANIQFVDAGDNKESATLGFYNLNNADLGDYLFGEFS
PPGENGQGIGYFNREALGGNVAGAPGTLNFAVLIHELGHGLGLAHPHDNGGGSPIYPGVT
SPFRSLGNLGLNQGIYTTMSYNSGFYSQNGNQEKLGYGLESTPMAFDIAAIQYLYGPNNS
YKTGNDTYYLPSVNQSGTSYSCIWDAGGVDTINGISAQSDVTIDLNDASLNTAQDGAGAG
GYVSSAKGIFGGFTIANSVVIENATGSNFNDQIIGNEFSNSLVGNDGNDTIDGGAGSDTI
NGGNGNDRLIGRAGSDRLTGGTGNDVLIGGAGNDVLLGGTGADRFLYDTEGAFARADVGQ
DTISDFNRSQGDKIVLDRTTFTVLSSTSGNSLAANDFAIAGLDILGIPLTGELLNAKIVY
NSTNGSLYYNQNGTAVGFGSGGLFATLSNEPTLAASDFIVQA
Download sequence
Identical sequences B2IWX2
WP_012410938.1.44837 gi|186684725|ref|YP_001867921.1| 63737.Npun_F4619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]