SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186684804|ref|YP_001868000.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186684804|ref|YP_001868000.1|
Domain Number 1 Region: 34-96
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000619
Family Phage repressors 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186684804|ref|YP_001868000.1|
Sequence length 104
Comment XRE family transcriptional regulator [Nostoc punctiforme PCC 73102]
Sequence
MDQSKRERLESKGWKIGTVSDFLELTLEETMFVEIKLALSQNLKERRQKLMTQSELAAKI
SSSQPRIAKAENGDASVSIELLIRAMLATGATPQDIGQVIAGVG
Download sequence
Identical sequences B2IXZ8
WP_012411017.1.44837 63737.Npun_F4701 gi|186684804|ref|YP_001868000.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]