SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186684822|ref|YP_001868018.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|186684822|ref|YP_001868018.1|
Domain Number - Region: 235-275
Classification Level Classification E-value
Superfamily Ava3019-like 0.0824
Family Ava3019-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186684822|ref|YP_001868018.1|
Sequence length 410
Comment hypothetical protein Npun_F4720 [Nostoc punctiforme PCC 73102]
Sequence
MSDKQVVESIQDKYDSLSPYLNEKTRRIWAAIEARSLGWGGVSQVALATGLSRTTIHAGI
RLLLDASGEKTSNDDSNRIRSSGAGRKLLEEKDAMLLSDLESLIEPVTLGDPESPLKWTS
KSVVKLAAALNIGGHRTSPKSVYNLLESLGYSLQSNRKTRDGSSHPDRDDQFLHISNQVL
HFQSQNEPVISVDTKKKELIGDFKNSGTEWCEKEQPIEVKMHDFVDPKLGKAIPYGIYDL
TSNQGWVNVGIDHDTAEFAVESIRHWWYSMGKQVYPSSEHIMITADCGGSNSYRSRLWKL
KLQELATDTGKTIHVCHFPPGTSKWNKIEHRLFCHITQNWRGRPLTSLQVVINLIRNTTT
TQGLEVEARLDPNLYKTGIKVTDQELDTIAIERNSFHGEWNYIIKPKVVS
Download sequence
Identical sequences B2IU87
gi|186686787|ref|YP_001869980.1|NC_010631 gi|186686878|ref|YP_001870071.1|NC_010631 63737.Npun_AF054 63737.Npun_AF165 63737.Npun_F4720 63737.Npun_R0923 63737.Npun_R1960 63737.Npun_R3306 63737.Npun_R3896 63737.Npun_R3976 gi|186681405|ref|YP_001864601.1| gi|186682357|ref|YP_001865553.1| gi|186683492|ref|YP_001866688.1| gi|186684026|ref|YP_001867222.1| gi|186684103|ref|YP_001867299.1| gi|186684822|ref|YP_001868018.1| gi|186686787|ref|YP_001869980.1| gi|186686878|ref|YP_001870071.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]