SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186685018|ref|YP_001868214.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|186685018|ref|YP_001868214.1|
Domain Number - Region: 114-158
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00592
Family Zinc protease 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186685018|ref|YP_001868214.1|
Sequence length 287
Comment peptidase M48, Ste24p [Nostoc punctiforme PCC 73102]
Sequence
MFNWKVFVANYRVWRRSWFYPLISVVVALSLCLSTPVPGRALDFLPLLLQGVQAFQLSNI
SPNQEVDLGKQINQELVGSQVRLYRNPEVNRYVEQVGRRLAVNSDRPNLPYTFQVVEDDS
INAFATLGGYVYVHTGLLKTADNEAELASVLAHEIGHIGGKHVVKQMQQKALESGLLSAA
GLDRNTAVQIGVQLARDLPRSRNNEFEADQRGLRTLTRTGYAQSAMVSFMQKLLKKGGSA
PTFLSTHPGTSDRIDALRRAINSQPSNGNYGLDNGSYKANIRPLVRS
Download sequence
Identical sequences B2J0B9
gi|186685018|ref|YP_001868214.1| 63737.Npun_F4926 WP_012411227.1.44837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]