SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186685069|ref|YP_001868265.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186685069|ref|YP_001868265.1|
Domain Number 1 Region: 4-244
Classification Level Classification E-value
Superfamily Hsp33 domain 4.19e-68
Family Hsp33 domain 0.0000045
Further Details:      
 
Domain Number 2 Region: 233-292
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 1.96e-18
Family HSP33 redox switch-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186685069|ref|YP_001868265.1|
Sequence length 301
Comment Hsp33-like chaperonin [Nostoc punctiforme PCC 73102]
Sequence
MADQLIRATAAEGGIRAVGVITTRLTEEARQRHKLSYVATAALGRTMAAGLLMASSMKRS
GSRVNVRVKGDGPLGGILVDAGLDGTVRGYVGNPSIELPPNAKGKLDVGGAVGGGYLYVV
RDVGYGYPYSSTVELVSGEIGDDVAHYLVNSEQTPSALVLGVFVGAGGVTAAGGLLIQVL
PKAARDEALVETLESRVAGLAGFTPLLQAGKNLTEIFSDLLGDMGLEIFSERQMLRFHCG
CSFDRVLGALKILGEAELQDMIVKDNGAEATCDFCSNVYQASSDQLAQLIADLQAESTVS
G
Download sequence
Identical sequences B2J191
WP_012411277.1.44837 63737.Npun_R4978 gi|186685069|ref|YP_001868265.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]