SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186685115|ref|YP_001868311.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186685115|ref|YP_001868311.1|
Domain Number 1 Region: 50-117,179-339
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 0.000000334
Family Isochorismatase-like hydrolases 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186685115|ref|YP_001868311.1|
Sequence length 344
Comment hypothetical protein Npun_R5025 [Nostoc punctiforme PCC 73102]
Sequence
MIAQTTTQLPIPPHFNPNKVGEVWRVPYQQIAATAEAWVKQHGIKAASSDKNRICLLLID
VQNTFCIPNFELFVGGQSGNEAVNDNVRLCEFIYRNLGVITKIIPTLDTHTATQIFHPIF
WVNAAGEHPTPAATNITLADIEQGIWKVNPAVANSVTNGDYELLEKHAYHYVRKLSQDGK
YPLTIWPYHSMLGGIGHALVSSVEEAIFFHSIARQSQTQFEIKGENPLTENYSILRPEVL
EDFEQRPLGQKNTRLIKQLLEFDTVIIGGQAKSHCVAWTIDDLLTEIKEVDATLAQKIYL
LEDCTSPVVVPNIVDYTEQADAAFARFAEAGMHIIKSSEFGNWA
Download sequence
Identical sequences B2J1D7
gi|186685115|ref|YP_001868311.1| 63737.Npun_R5025 WP_012411322.1.44837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]