SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186685601|ref|YP_001868797.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186685601|ref|YP_001868797.1|
Domain Number 1 Region: 10-65
Classification Level Classification E-value
Superfamily Rubredoxin-like 1.35e-20
Family Rubredoxin 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186685601|ref|YP_001868797.1|
Sequence length 111
Comment rubredoxin-type Fe(Cys)4 protein [Nostoc punctiforme PCC 73102]
Sequence
MSEPAVETPVLDRYECRACGYVYEPEKGDDKHDIPSGILFAELPTNWRCPVCSAKKTAFA
NIGPAGTASGFKENLGYGLGVNNLTPSQKNILIFGALALGFLFFISLYGLQ
Download sequence
Identical sequences B2J6S8
gi|186685601|ref|YP_001868797.1| 63737.Npun_F5549 WP_012411798.1.44837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]