SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186686208|ref|YP_001869404.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186686208|ref|YP_001869404.1|
Domain Number 1 Region: 1-69
Classification Level Classification E-value
Superfamily Homeodomain-like 1.63e-25
Family Alr1493-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186686208|ref|YP_001869404.1|
Sequence length 74
Comment hypothetical protein Npun_F6175 [Nostoc punctiforme PCC 73102]
Sequence
MQYQNIITIEPGKRGGKPCIRGMRITVYDVLSYLASGMTYEELLDDFPYLTQEDILACLS
YAADRERQMLTMQA
Download sequence
Identical sequences B2IW00
WP_012412401.1.44837 63737.Npun_F6175 gi|186686208|ref|YP_001869404.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]