SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186686503|ref|YP_001869699.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186686503|ref|YP_001869699.1|
Domain Number 1 Region: 271-364
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.000000000000837
Family Barwin 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186686503|ref|YP_001869699.1|
Sequence length 368
Comment lipoprotein A [Nostoc punctiforme PCC 73102]
Sequence
MNQRHLWIIVALSMAVLGIPSVGCTQTTKGNALASQKSPAPDVVKVGEYQSRTGRQTLDA
VITEIHPHNIRGRKAATLFIRNIPVLTFLSSVSNTNLETKKVGAIGNTGGVQGYALIASN
SPKALNADDVTDVSNQISSSDNDPVQIAGVVAAKINQLNRESVDGSKITVSWKAGEKSNA
NQAQNKSAPSQQDGDRYVIKINGEELVEINEATRLAQTNPTKNLAEDALQATNRLRRLLG
NASPLKEIANLPVRQISIPKLPQQIAVGAVQATLRGMASFYGYDGSGTQTASGQRFNPEA
MTAAHRSLPFGTQVRVTNTRNGRSVVLRINDRGPYIRGRVIDVSAGAARVLGMMGSGVAP
VHIEVLGK
Download sequence
Identical sequences B2IZB4
gi|186686503|ref|YP_001869699.1| 63737.Npun_R6493 WP_012412692.1.44837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]