SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186686542|ref|YP_001869738.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186686542|ref|YP_001869738.1|
Domain Number 1 Region: 246-411,487-577
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.9e-33
Family Serralysin-like metalloprotease, catalytic (N-terminal) domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186686542|ref|YP_001869738.1|
Sequence length 905
Comment hypothetical protein Npun_F6533 [Nostoc punctiforme PCC 73102]
Sequence
MKYWIGKLAIFIVLLYNLFIYSDYAGANQLSNIDVQQANALPAVENLANTDNDIAKNRKE
NFCRFNEVVKGINKVEGLFTLYCTENSGKIYLEIKPEQLNKDYLAIATLESGVGESGIYS
GLPLSDFIFYFQRVNNRLHFVVRNVKFRAESRPEQRSLARSFSDSVLYSLEIANIDPQNE
NILIDLNELLMQDLPGLTTILKYSLQADYRLDAHKSYFGNVNSFPENIEIDSIYGFSSLE
GANLVTVPDSRALTLKVHYSFSQLRENNDYIPRLADDRVGYFITAFQDLSNKNPHESFVR
YINRWHLEPSNPNVPLSPPKKPIVYWIENAVPLEYRDAIREGVLMWNKAFEKAGFQNAIE
VQQMPDDADWQPADVHYNTIRWFNSLDAGFARGPMRVNPFTGEILDADIMVDANMVLSIQ
QEYHALMEVNPSLVGKNPCQALWGSQKLGANNSLLPDSEFCYGMESSNQAAMGALALSIL
PNTTASSETMKEYVYQYLRSLIAHEIGHTLGLRHNFHGSTMLAPEELNNTEITHTKGLVS
SVMDYLPVNIAPQGVQQGDYFPGVVGPYDEWAIEYGYKTSPSAVLEGIIPESEKSFLEQI
ALASPQPELSYATDEDIWDINPLANVWDMSSDVLLYSQWQMDNARVMWQRLDKGYLSKGE
SYNNLRVSFNRVLKYYFRNATLLSKYIGGQSFLHLHTSDNPSWTFVPVSLLKQRQALIKL
QEYVFAENAFSFSPQLLNKLAPSRWEHWGRSVPNNRLDYPIHDRILGFQSAVLRSLLDSD
RLNRLQDIELKTLPGEALSIPELFHTLQTGIWAEVLTPGEPKPISSIRRSLQREYLNILL
EMMLGTTDTLEDGRTLAWYELRQLQKAIDVRLKQLSESIDIYTLAHLEASGDRITKALNA
HLLSK
Download sequence
Identical sequences B2IZF3
WP_012412731.1.44837 gi|186686542|ref|YP_001869738.1| 63737.Npun_F6533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]