SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186686686|ref|YP_001869880.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186686686|ref|YP_001869880.1|
Domain Number 1 Region: 10-72
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000174
Family SinR domain-like 0.049
Further Details:      
 
Weak hits

Sequence:  gi|186686686|ref|YP_001869880.1|
Domain Number - Region: 78-127
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 0.0251
Family DnaJ/Hsp40 cysteine-rich domain 0.01
Further Details:      
 
Domain Number - Region: 122-144
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0447
Family Rubredoxin 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186686686|ref|YP_001869880.1|
Sequence length 155
Comment XRE family transcriptional regulator [Nostoc punctiforme PCC 73102]
Sequence
MDTFKTPNSDESLASYVSRVRKKLNLTQSELADAAGIHGRSVGKIERGLTLKINRRTLQG
LAIALGVPQEYFDAVIKGEEVSQVRGVKFCPQCWNPGAAVDPMWSHIKAKFCYLCGTPIR
ANCANCGELVLSLRHRFCPICGCAYKTPVKTAKIQ
Download sequence
Identical sequences B2IU29
gi|186681347|ref|YP_001864543.1| gi|186686686|ref|YP_001869880.1| gi|186686753|ref|YP_001869946.1| gi|186687045|ref|YP_001870434.1| gi|186687122|ref|YP_001870265.1| 63737.Npun_AR015 63737.Npun_BF081 63737.Npun_CR025 63737.Npun_DR049 63737.Npun_F0863 gi|186686686|ref|YP_001869880.1|NC_010630 gi|186686753|ref|YP_001869946.1|NC_010631 gi|186687045|ref|YP_001870434.1|NC_010633 gi|186687122|ref|YP_001870265.1|NC_010632 WP_012407622.1.44837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]