SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186686692|ref|YP_001869886.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186686692|ref|YP_001869886.1|
Domain Number 1 Region: 15-75
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000174
Family Phage repressors 0.042
Further Details:      
 
Weak hits

Sequence:  gi|186686692|ref|YP_001869886.1|
Domain Number - Region: 124-147
Classification Level Classification E-value
Superfamily NOB1 zinc finger-like 0.00101
Family NOB1 zinc finger-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186686692|ref|YP_001869886.1|
Sequence length 155
Comment XRE family transcriptional regulator [Nostoc punctiforme PCC 73102]
Sequence
MIVTEHSTRPLGEEGLANYVQRLRGQLSLTQKELSFKAGIHIQTIRKIEGGQTNRLNQKA
KGGLAAALGIPPEYLDAAAKKVSPETITTLKFCPKCWTPGTTPDQMWTDLRSKYCFACGT
ALRNRCVSCNEPIMSLKFKFCPYCGANYKQNQTTS
Download sequence
Identical sequences B2JBS1
gi|186686692|ref|YP_001869886.1|NC_010630 WP_012412872.1.44837 gi|186686692|ref|YP_001869886.1| 63737.Npun_CR034 370450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]