SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186686706|ref|YP_001869900.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186686706|ref|YP_001869900.1|
Domain Number 1 Region: 34-320,396-427
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.87e-84
Family Type II chitinase 0.00000527
Further Details:      
 
Domain Number 2 Region: 448-759
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 4.13e-31
Family Bacterial PLC 0.04
Further Details:      
 
Domain Number 3 Region: 320-396
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.000000000000301
Family Chitinase insertion domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186686706|ref|YP_001869900.1|
Sequence length 785
Comment glycoside hydrolase family protein [Nostoc punctiforme PCC 73102]
Sequence
MSNRFSRRKFVKFAGGVIAGSAAVGSAPLVNLLAANAQSSTGYKVVGYFENWSQYRQGGG
KFLPAQIDPSLYTHINFAFGIFGYITKGIAPNNPRLTGDYRIQPIEWNDQTVLYPEIQKL
KLKNPNLKTLLSIGGWGFNDPQDPIQIGTYTYNLFSQMAASAAGRQQFIYSALEYAQKYK
FDGIDLDWEYPGYQGRGGRPEDFANFLALVREFRTAISGRNFLLTIASSAIVPSGVPDQY
RSNPGSYFQWLAQCAQYLDWLNVMSYDYHGAFPDDKVTGMNAPLPQDSTPKGPFSVKNTI
EAYLAAGIPNSKIVMGIPTYGRTFKVSSPLSLTDNGPGKSYSSVGPAGISTVTPGVLSYY
EIQNRISSGSLTRRWHEPTLTPYAYNSQTSEWVSYDDTESIGYKTSYLIEKKLGGAMIWA
IGLDQFQSGFPLIKRVKSILDNPALRPKLPSYFVSGGRRYNQYSFLCTHNSFANSDENWT
AANQFNTITKQLNDGVRALMLDIYNAEFDSLLGGKGVYLLHNFNPNASFPGINYALPLKH
LYDALNEVVAFLKNNRNEVVTIFLEDYVYPDTNKLKEELDKVTGLKELIYDPDNNPNWSV
RVTGEWPLLSEMIEWNKRLIIFSDKNHNNLTTKIGVAYDRNYILQNFWSLGVGGTDWDCQ
SRWRDGYHYQIVPEGTPYSQWRYADPQLHPKVVEKKSALFLFNHFRDTPTRITAALDNTY
DKIMDRIENRCCNSAFLPKEKTTKQLPNFVAVDFWQEPVLYNNKAANVVQELNRRWENKL
GCANR
Download sequence
Identical sequences B2JBT5
gi|186686706|ref|YP_001869900.1|NC_010630 63737.Npun_CF051 gi|186686706|ref|YP_001869900.1| WP_012412886.1.44837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]