SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186686758|ref|YP_001869951.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186686758|ref|YP_001869951.1|
Domain Number 1 Region: 32-123
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 3.49e-26
Family ParB-like nuclease domain 0.00043
Further Details:      
 
Domain Number 2 Region: 113-145,179-257
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 3.79e-17
Family KorB DNA-binding domain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186686758|ref|YP_001869951.1|
Sequence length 307
Comment parB-like partition protein [Nostoc punctiforme PCC 73102]
Sequence
MSIKRDKPYGRRLKGLEALIGESVDTVPCGQFVTIEKIQLSVQQPRRYFDPKKLEQLVQS
VKEHGILEPLLVRYLSNDKYELVAGERRYRAASLAGLTEVPVIARSLNDQEALQLSLVEN
LQRDDLNPIEETEGILELIALQLDKRVPEVISLLYKMQNILAGKVTDNVISNSDAEDVKM
IFTGLGLMEWESFTANRLPLLRLPDEILEVLRQGKIEYTKAKVIAKLKEKTERIALLEEA
ILQNLSLNEIRERLKTRKSSTEEKELEKQIDSTYKKMKKSKLWDNPKKRKKLELLFAQIE
ILINEDD
Download sequence
Identical sequences B2JAF6
gi|186686758|ref|YP_001869951.1|NC_010631 WP_012412932.1.44837 gi|186686758|ref|YP_001869951.1| 63737.Npun_AF021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]