SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186686832|ref|YP_001870025.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|186686832|ref|YP_001870025.1|
Domain Number - Region: 166-212
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0391
Family Group I mobile intron endonuclease 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186686832|ref|YP_001870025.1|
Sequence length 226
Comment hypothetical protein Npun_AR109 [Nostoc punctiforme PCC 73102]
Sequence
MATYRQLTIWDVLDEMSVAPPTSTLAPVWKCLDTELENLSTEAQLSTAAEAFYQIADILK
SRAESILEDVRAQNDTDGPIISTDIFAGLVRTIMHLDLDDLIEPEIPQTFRSHGPHQFSY
PTELGDSVAAPVEKANVLAMLDEVTTLEDVRNLASDEDVEKWQSAIANYLINVKDEISLV
KLQRVLQMPMVEVWLGLLLGGFTLEQRGDFYHNHNVWVKSSPSYHQ
Download sequence
Identical sequences B2JAN0
WP_012413004.1.44837 gi|186686832|ref|YP_001870025.1| 63737.Npun_AR109 gi|186686832|ref|YP_001870025.1|NC_010631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]