SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186686902|ref|YP_001870095.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186686902|ref|YP_001870095.1|
Domain Number 1 Region: 217-448
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 3.3e-65
Family DNA/RNA non-specific endonuclease 0.000000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186686902|ref|YP_001870095.1|
Sequence length 450
Comment DNA/RNA non-specific endonuclease [Nostoc punctiforme PCC 73102]
Sequence
MQTDYWTYEVKLDLVLFNFWRKVYRNGWLTGVVIVLLITFNTLFSAKGATTVEGFETGSK
GSYASSDVTLSTGLWNLDDALIGNLTSDAKSGTQSARIRNSGKVSMKFDRSTGAGTVSIK
HAKFGSDGSTNWQLWCSSNSGISWLQVGSTVTTSSTTLQTATFTPNISGTSRCEVRKSDG
TTNRTNIDDITITDYGTSGGGGSTSVHLTMGNPSGAGASDINNYLLDKAQYAVGYNCSLG
RANWVSWQLNSSWLGSTPRQDDFRADTTLPAGCYQVQSTDFSGSGFDRGHMTPSGDRTST
VTVNSSTFLMSNMIAQAPDNNQGIWANLEDYARTLVSQGKELYIISGGYGVGGTGSNGTF
STIAGGKVTVPNRTWKILVVLDTPGSGVSGVTTSTRVIAVNIPNAQGVRTADWRNYRVSV
DSLESLTGFDFLSLVSTSIQSVIEAQVDNL
Download sequence
Identical sequences B2JAV0
gi|186686902|ref|YP_001870095.1|NC_010631 gi|186686902|ref|YP_001870095.1| 63737.Npun_AR195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]