SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186687050|ref|YP_001870193.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186687050|ref|YP_001870193.1|
Domain Number 1 Region: 61-139
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 5.76e-16
Family ParB-like nuclease domain 0.0022
Further Details:      
 
Weak hits

Sequence:  gi|186687050|ref|YP_001870193.1|
Domain Number - Region: 227-312
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.00366
Family KorB DNA-binding domain-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186687050|ref|YP_001870193.1|
Sequence length 374
Comment parB-like partition protein [Nostoc punctiforme PCC 73102]
Sequence
MARSKVDLTKMFSTAAQMSDAEVEINKLQVEVERLRALQAPELEAQIAALREQLTMQSGQ
QEIDITLICPNPEQPRKTFSAQSINSMARTLEKDGQLQPVILITQGSGFDLFDGERRWRA
GMQLNWKTLKSVVMPRPQDLHRKALLTTLYREDLNPLDKAEALLKEISEQTEVNLAEAPR
ILATAVRRLEYQKRMKQVGELIGESDEKQNQVLNDLDLNDAEKQIFKVLLDLGLNPASVT
ANDFRMLSLFPDLQAAIRDSNLKAAHAMVLQRLSAKKLEVDEKKVVKIRVETTQKVVEQN
LTLLETQELVNQIISNNAPKPASDPNDKQVKNIMRGLKELSVDKIERSNLKKFHQSLQQK
LKEIEAVLQADDYS
Download sequence
Identical sequences B2JB48
63737.Npun_BF002 gi|186687050|ref|YP_001870193.1| gi|186687050|ref|YP_001870193.1|NC_010632 WP_012413165.1.44837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]