SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186687053|ref|YP_001870196.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|186687053|ref|YP_001870196.1|
Domain Number - Region: 51-75
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.0471
Family Intron-encoded homing endonucleases 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186687053|ref|YP_001870196.1|
Sequence length 101
Comment HNH endonuclease [Nostoc punctiforme PCC 73102]
Sequence
MSKTRYSKDWKQIATAVKDASNWRCTKCDRICLRPGEKPSELTLSQRRVYNLQVHHYNFD
PSDNRKENLGCLCSGCHLHYHRFRRGNISPGQLSLFQLNDA
Download sequence
Identical sequences B2JB51
63737.Npun_BF005 WP_012413168.1.44837 gi|186687053|ref|YP_001870196.1|NC_010632 gi|186687053|ref|YP_001870196.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]