SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186687130|ref|YP_001870273.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186687130|ref|YP_001870273.1|
Domain Number 1 Region: 239-408,693-729,1025-1119
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.5e-32
Family Tandem AAA-ATPase domain 0.0066
Further Details:      
 
Weak hits

Sequence:  gi|186687130|ref|YP_001870273.1|
Domain Number - Region: 1683-1773
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.00029
Family Very short patch repair (VSR) endonuclease 0.052
Further Details:      
 
Domain Number - Region: 1379-1403
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00459
Family Rubredoxin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186687130|ref|YP_001870273.1|
Sequence length 1782
Comment DEAD/DEAH box helicase domain-containing protein [Nostoc punctiforme PCC 73102]
Sequence
MKLPIKLQDLLQQNESAIVAASTFLSQKLALLDCTGVVTVTSEQLALLFSSIPEDWDFQE
FEELLNISTVNPIFYHQLQEWINQRLGNTQAEPPSTNEELANTNDLDIFNFRNEVIDDYR
RYIESFLKIRDRKVKEFVDAELDKGQLWTDPLVQLNPSYKKGATAKELVQQQILHPDSEK
YFCRKDGTPFTFHYHQKQAFETAQRQQPYVVTTGTGSGKSMTYVVPIFDDLLRHPEILGV
RAILVYPMNALINSQKEELDKFLRQVPNTHIRVEKYTGQESLTRKTEIQNNPPHILLTNY
VMLELMLSRTHENKLVESPNLKFLVLDELHTYRGRQGADVAILIRKLRQRSKSNDELLCI
GTSATMSTVGSREQRRQVVADVASKLFGVEIKPSNVIDETLERSIQRVEPTIEQLCQGIL
AGLPTELEQTLTEFRNHSLSHWIEMNFGLEEREGHLVRRQPISLETGATKLAEQTQLVEE
TCLTVLKQMFLWGSKTNGLAFRLHQFISQGGSVYATIENRDKRHLTLEGQYTTTDNRLLY
PLVFCRECGQDYYVVRYDADKHIILPQLPTALDISPDDADITEGYLTLDEPELWDTSDED
RLPDSWFSETKKKGRVAKKDFVRFIPRKLQILPNGKVTSSLLQETTCWFIPKPFLTCLNC
GVLHDKKRNEFAKLSRLSSEGRSTATTLLCLSTTSRLKQVFTGEKAKAAKILSFTDNRQD
ASLQAGHFNDFVQTSFLRAALLGAIQAKGKLTHSELASVVVQYMGITQNDYAKQAAEFGV
GKRRNEEAFRKLIEYRLYEDLRRGWRIVQPNLEQCGLLIIEYDGLQEACADNNLWQKHRH
PLLLQATPQQRFIITQAFLNHLRRELAIDAKLLQPDQKDSLKSEVIQALKEPWVFDENEY
LYLATWATISTGGNEKAKVKLTTRSKIGRFLRSPNTWSLRSQLLTDVEFNSLITTLIDAL
CDAGYLVQEKSEVQLRIDSLLWKATNLKEIPTDPLTSRRLQGNDKPNISVNQFFQGFYQT
NALQIQTMEGREHTGQVSNKDRQEREEKFRQGQLAALFCSPTMELGIDISDLSVVHLRNV
PPSPANYAQRSGRAGRSGQQALVITYASIGSGHDQYFFKRQNQMVAGVVAPPKLELANQD
LIKSHVYSIWLAHTGVYLEDSMNKILDLELENYPLKDSIRQQLTLSQAKLTQCLQAAQSI
FSDFFCQEDLQKASWYSVNWLQNTIENALNAFDRACKRWRDLYIESVKQLESARRTIDRF
ARGDIAQEERNNAEAQAREAQRQIDLLVGHSQGKSNSQFEFYPYRYFAAEGFLPGFNFPR
LPVRAFIPAGEGGEFISRPRSMALREFAPNNILYYEGSKFMVAKTKVPVGGIEGEYKRVS
VCANCGYYHDGDFRDTCENCGAEIKPDAHGNVAKLTRVLPMETAIARRRERITCDEEERL
KYGYNITTHFRYASQKRESAIVQAADGTPLFKLTYGATATIWRINRGLKKNREERGFKLN
PTTGVWGDHKNPQAQQTPDSLHTEVNLMVDDTCNILIVEPLNVPVEDREAFIATLQYTLE
TAIQAVYKLEADELDSERLGEGKYLLFWEAAEGGAGVLSQLLEKPEAFRKIADAAFDICH
FTQPKDSCIQACYECLLSYRNQFDHALINRHLIKPWLDLLLESSVITQVKGLSRDQQYQK
LLEQTDPNSDFERVVLQEIYQRGYKLPDAAQQFIPEANCKPDFVYEEEAIAVFCDGSVHD
SPDQRKQDKIERDNLRYNTGYTVLTLRHDEDWQTKLDILAGL
Download sequence
Identical sequences B2JBC8
gi|186687130|ref|YP_001870273.1| gi|186687130|ref|YP_001870273.1|NC_010632 63737.Npun_BF093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]