SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186680655|ref|YP_001863851.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186680655|ref|YP_001863851.1|
Domain Number 1 Region: 25-278
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.92e-39
Family Phosphate binding protein-like 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186680655|ref|YP_001863851.1|
Sequence length 308
Comment molybdate ABC transporter periplasmic molybdate-binding protein [Nostoc punctiforme PCC 73102]
Sequence
MKKHFFAFSLIACAVSVIPTKALAVNLYGAGSLRDSLTEVAESFSEKYGIPVETRFGPSG
LTREFIEQEFSKTGKSADVFASADVDNPQTLFQEGLSEPVVNFTSNRMVAVVRSGLGITS
NNLLNFLLKPEIKLGTSTPIADPSGNYAWQIFDKSDQITPGNSQILKNKALQLVGGNPNA
PIVPNGKNNLVYFLEETKQADIFLAYYTSGKTAQVTAGGENLQIVELPDYLATKANYGLT
TLKNADPDGEKLAEYILSPEGQEILTKYGFSSPSTSVPEHQGAGGVLLALGLALILNTKQ
RIKSESRS
Download sequence
Identical sequences B2J3H8
WP_012406937.1.44837 63737.Npun_R0107 gi|186680655|ref|YP_001863851.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]