SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186685548|ref|YP_001868744.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186685548|ref|YP_001868744.1|
Domain Number 1 Region: 203-337
Classification Level Classification E-value
Superfamily CBS-domain pair 6.06e-28
Family CBS-domain pair 0.0047
Further Details:      
 
Domain Number 2 Region: 350-430
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.23e-23
Family CorC/HlyC domain-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186685548|ref|YP_001868744.1|
Sequence length 442
Comment hypothetical protein Npun_F5495 [Nostoc punctiforme PCC 73102]
Sequence
MSPITFEILIILVLIIANGVFSMSEMAIVSARKVRLQQLANQGDAKARAALKLAESPNHF
LSTVQVGISLIGILTGAFGGATIANRLAVYVKLVPLLAPYSEPISFGIVVLIITYLSLIV
GELVPKRLALNNPERIASIVAIPMQALAAIASPVVYLLSTSTDLILRMLGITASTEPQVT
EEEIKILIEQGTEAGTFEEAEQDMVERVFRLGDRPVSYLMTPRPDIVWLDLEDTAEENRQ
KMVDSAYSRYPVCQAGLDNVLGVIPVTDLLARSFRGEPLDLTVGLRQPVFVPESTRGLKV
LELFKQTITHMALVVDEYGVIQGLVTLNDIMSEIVGDVPSTDGQDQPQAVQREDGSWLLD
GMLPVEEFLELFGMEEWESEERGSYQTLGGFVITHLGRIPAAADHFEWQSMRIEVMDMDG
NRVDKVLVVPKATKSADTKKSD
Download sequence
Identical sequences B2J5R9
WP_012411746.1.44837 gi|186685548|ref|YP_001868744.1| 63737.Npun_F5495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]