SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186685654|ref|YP_001868850.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186685654|ref|YP_001868850.1|
Domain Number 1 Region: 65-358
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.93e-90
Family Thermolysin-like 0.0000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186685654|ref|YP_001868850.1|
Sequence length 359
Comment peptidase M4, thermolysin [Nostoc punctiforme PCC 73102]
Sequence
MARNKKKSAGFKYEHPLVSRCPICCIIPPHILEHVVVNGNPQQRNWAFRTLNVSAQFRGR
RDVIGTVSFAPSPGEKRRTIYDAKYGQQLPGTLVRGEGDPPSSDIAVNEAYDAAGATYDL
FYEIFDRNSVDDKGLRLDSTVHYGVKYDNAFWNGDQMVYGDGDGEMFQRFTTSIDVIGHE
LTHGITQYEAGLQYYGEPGALNESFSDVFGSLVKQKSKNQTAQEADWLIGEGLLVPTVKG
VALRSMKAPGTAYDDPVMGKDPQPAHVKDKYTGTDDNGGVHINSGIPNHAFYLAAVSIGG
YAWEKAGKIWYIALRDRLKAKADFKKAASVTIQIAGELYGNGSDDQKAVQDAWQKVGVI
Download sequence
Identical sequences B2J7U2
63737.Npun_F5602 WP_012411851.1.44837 gi|186685654|ref|YP_001868850.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]