SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186685854|ref|YP_001869050.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186685854|ref|YP_001869050.1|
Domain Number 1 Region: 72-310
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.52e-41
Family Transferrin 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186685854|ref|YP_001869050.1|
Sequence length 324
Comment phosphonate ABC transporter periplasmic phosphonate-binding protein [Nostoc punctiforme PCC 73102]
Sequence
MSVRKKSLLGAGAAFVVLTGLVVSTVGAMQATIANPTANQQTPRLLAQNLKALTIIFPSR
ADSTDLQNKANAVGAFLSKELGIPVVAQVGDDTAAVEALRANRADVAFLSSRPALKAKQL
ANASLYLAEVRPTYSGRYTYSSTFVVPKNSPLKTQNSAKATLEQLRGKKIAFTSPTSGSG
FIIPVAELVKQKFVPNRDRLDGFFGQISYGGNYSKALQAVVRGQADVAVVSEYALNPPYI
TAEEKSKLRVLHKINGVPAHGIAIDDDVPAPTREKIINGLLKLNKSQNNKLLTDLYNSTE
LVRIDHDRHLATIRNALQIAGIEP
Download sequence
Identical sequences B2J991
63737.Npun_R5809 WP_012412050.1.44837 gi|186685854|ref|YP_001869050.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]