SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187477734|ref|YP_785758.1| from Bordetella avium 197N

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187477734|ref|YP_785758.1|
Domain Number 1 Region: 177-346
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.51e-37
Family FemXAB nonribosomal peptidyltransferases 0.012
Further Details:      
 
Weak hits

Sequence:  gi|187477734|ref|YP_785758.1|
Domain Number - Region: 13-82
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0139
Family N-acetyl transferase, NAT 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|187477734|ref|YP_785758.1|
Sequence length 376
Comment hypothetical protein BAV1236 [Bordetella avium 197N]
Sequence
MIDTYRLQVDTPLDSLDPAQWDRLTGGHPALSHAYFSALHDTGCASPRTGWTPFFLSLHQ
GDTLAGAVPLYLKTHSRGEYVFDYAWADAYERHGLRYYPKLLAAVPFTPVSGPRLLAAHA
PARAVLARGLIELTAALKLSSLHVLFADQTDIEALREAGCMLREGVQFHWRNAGYTNFDA
FLASFNHDKRKKLRQDRKKVQDVRFRHLRGRQIGSAELAFFYACYERTYREHGNPPYLTL
AFFERLLATQPDTLVMVIAERDEAPLACALNLRGGDTLYGRYWGAMTFLPGLHFETCYLQ
AIEYCIKEGLSRFEGGAQGEHKMARGLLPTPTWSAHWIADPRFAAAIDDFLGHETQAINE
YLDELARHTPLRRGEP
Download sequence
Identical sequences Q2L344
WP_012416918.1.34902 WP_012416918.1.73991 gi|187477734|ref|YP_785758.1| 360910.BAV1236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]