SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187478173|ref|YP_786197.1| from Bordetella avium 197N

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187478173|ref|YP_786197.1|
Domain Number 1 Region: 156-342
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.53e-70
Family Methylesterase CheB, C-terminal domain 0.000000171
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 2.28e-28
Family CheY-related 0.00000527
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|187478173|ref|YP_786197.1|
Sequence length 351
Comment chemotaxis-specific methylesterase [Bordetella avium 197N]
Sequence
MKKIRVICVDDSALVRGLMTEIINSHPDMEVVATAPDPLVARELIKQHNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTERGGEITMRALELGAIDFVTKPRLGIRDGLLDYS
ELIADKIRAASRARLRGPAPVAAAALPARLRSPLNSSEKLVILGASTGGTEAIREVLLPL
PPDSPAILITQHMPAGFTRSFAQRLDTLCAVTVREATHGERVLPGHVYLAPGGEQHMKLG
RSGANYVIELEAGEPVNRHRPSVDVLFHSAAQAAGRNAIGVLLTGMGKDGAAGLLAMKRA
GAYTLAQDEASCVVFGMPREAILLGAADEVVPLPAMSERILMRAGDRGHRV
Download sequence
Identical sequences Q2L1D1
WP_012417348.1.34902 WP_012417348.1.73991 gi|187478173|ref|YP_786197.1| 360910.BAV1679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]