SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|187478619|ref|YP_786643.1| from Bordetella avium 197N

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187478619|ref|YP_786643.1|
Domain Number 1 Region: 5-143
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.15e-36
Family N-acetyl transferase, NAT 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|187478619|ref|YP_786643.1|
Sequence length 146
Comment acetyltransferase [Bordetella avium 197N]
Sequence
MNQNSLRIVIGTWDRLREHAARVRHEVFVLEQGVSPEIELDDEDAVSVHAVAYDAQGEPI
GTGRLLQDGHIGRMAVRKLARGQGVGGQILDALIEQGHGDGHRMLVLHAQTHARSFYEAH
GFQAAGEEFLEAGIPHVVMTRELARG
Download sequence
Identical sequences Q2KZA7
WP_012417791.1.34902 WP_012417791.1.73991 360910.BAV2126 gi|187478619|ref|YP_786643.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]