SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187478628|ref|YP_786652.1| from Bordetella avium 197N

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187478628|ref|YP_786652.1|
Domain Number 1 Region: 4-167
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 7.09e-43
Family N-acetyl transferase, NAT 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|187478628|ref|YP_786652.1|
Sequence length 194
Comment spermidine N(1)-acetyltransferase [Bordetella avium 197N]
Sequence
MTATASDIQLRPLERGDLHFVHAMNNNDAIMRYWFEEPYEAYDELIALYDRHIHDQYERR
FIIEHVAGQMVGLVELVEINHIHRRAEFQIIIAPDFQGQGFAKAATRVAIGYAFRVLNLH
KVYLLVDKDNLAAVHIYRSCGFSVEGELREEFFSNGRYRDAYRMSILQAEYLRDYGSIPD
HASVLRNWSPGASA
Download sequence
Identical sequences Q2KZ90
360910.BAV2135 gi|187478628|ref|YP_786652.1| WP_012417800.1.34902 WP_012417800.1.73991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]