SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187479446|ref|YP_787471.1| from Bordetella avium 197N

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187479446|ref|YP_787471.1|
Domain Number 1 Region: 127-271
Classification Level Classification E-value
Superfamily Succinyl-CoA synthetase domains 1.7e-32
Family Succinyl-CoA synthetase domains 0.00036
Further Details:      
 
Domain Number 2 Region: 277-435
Classification Level Classification E-value
Superfamily Succinyl-CoA synthetase domains 9.55e-28
Family Succinyl-CoA synthetase domains 0.00094
Further Details:      
 
Domain Number 3 Region: 652-803
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.22e-19
Family N-acetyl transferase, NAT 0.0056
Further Details:      
 
Weak hits

Sequence:  gi|187479446|ref|YP_787471.1|
Domain Number - Region: 505-601
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 0.00547
Family Succinyl-CoA synthetase, beta-chain, N-terminal domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|187479446|ref|YP_787471.1|
Sequence length 828
Comment acetyltransferase [Bordetella avium 197N]
Sequence
MLRHVLAPLFEPRSLLIVADRTLPATSVLPGPLRARATLVDSPPGEAPELPERCNGLEEG
ERVDLALVCVSPAVLPETLRRLERLAPRALILLPHELPDPYPRGTLALCEEWARAHHCQL
LGPRAFGAQRPHAGLNLSQHPTLARAGRVALVAQSRSIMAAVMDWAEDVHIGFSLAVSLG
DEAVLGMSEVLDYLASDPRTDSIVLYLEDMGPARDFMSALRAAASVKPVIVLKAGRGEEG
PADAVFDAALRRAGAVRVRYFVQLFSAVKVLGYARRPRGRRVALLSNGSGPPQLALDLIG
PDAAVLKADLSPATQRALAALLEPDAQTRNPVITYTPLTPELLQQLLDCLIDDAGVDGVL
VLLAPDALADMPAVARQLAQLAPKARKPVVSCFMGDAGMRPLRRMLDDAGTPAFRTPESA
ADAFGVLATHYYNQQLLLQTQPPEAPGGPPDMATARALLAQLREQGRRELTESECRVLLK
AFRVPLRDSPLDLGSGEPESRPMAIRVRTDSRFGPVIRFGAGGSDALLSVAERGMDLPPL
NNFLARKLIERSRIWRRVLAAQVSNAATEALQHALVQVSELVSELPDIQSLDIDPLYAGE
TQLRAGGLRMTLTEAPACPAPQITGYTHMAIHPYPSQLVQMCSFEDGTPWVIRPIRPEDG
EPLQAFIRGLSERSRYMRFVSMMRELTPRMVARYTQVDYHRELALVAATQVPNPANRGHP
HEVIIGFAHYLRNPDGRGAEYALVIADDWQRRKLGGQLMTALIKAARAQGLEYIDGLVLS
TNRPMLTLMTRLGFTNDRDTDDPSMRRVWLTLRPDPDAEIKAASHPPD
Download sequence
Identical sequences Q2KUZ0
360910.BAV2976 gi|187479446|ref|YP_787471.1| WP_012418615.1.34902 WP_012418615.1.73991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]