SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187477457|ref|YP_785481.1| from Bordetella avium 197N

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187477457|ref|YP_785481.1|
Domain Number 1 Region: 12-266,398-459
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.85e-41
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0016
Further Details:      
 
Domain Number 2 Region: 263-399
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1.33e-20
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|187477457|ref|YP_785481.1|
Sequence length 465
Comment reductase flavoprotein subunit, partial [Bordetella avium 197N]
Sequence
VSAPQVLRGAAPDAVTVHVPIAIIGAGACGLTAALRLADAGIETVLIERDAAPSGSTALS
SGFIPAAGSAAQHAAGIEDDALRFVADIQAKAGGAAAEHLVAAYAGASAAALDNLARHGL
TFEVLDGFLYPGHTARRMHTLPERTGAALVAALERAATQAGAYLLTRALARQIWTDEDGR
VTAVGCERPDGSIDVIGCDVLLLACNGFGGNAAMVAQHLPAMREAVYGGHVGNDGSAIEW
GAQLGARLADMGGYQGHGSWATPQGALISWAVIMDGGVQINREGRRFHDETHGYSEAAVH
VLAQPGGVAWNVFDDRTLALARGFPDFVQAEAGQALKTCADSAALAALIGCDAGVLRQTL
ADAAPGISDAHGRRFERALLAPYHAVKVTGALFHTQGGLDIDAHCRVLDQAGRALPNLLA
AGGAARGVSGNEVSGYLSGNGLLSAVAGGHIAAATAASLLGREFS
Download sequence
Identical sequences Q2KVL0
360910.BAV0956 gi|187477457|ref|YP_785481.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]